Limitation of mind- Kaivalya Pada-Patanjali Yoga Sutra
Patanjali Yoga Sutra – Kaivalya Pada Limitation of mind 4.20. Ekasamaye chobhayanavadharanam| Ekasamaye-simultaneously Cha-and Ubhaya-both Anavadharanam-non-comprehension And there cannot be the comprehension of both simultaneously.
Mind & object – Kaivalya Pada – Patanjali Yoga Sutra
Patanjali Yoga Sutra – Kaivalya Pada Mind & object 4.16. Na chaika chittatantram vastu tadapramanakam tada kim syat| Na-not Cha-and Eka-one Chitta-mind Tantram-dependent Vastu-object
Mind is not self-illuminative- Kaivalya Pada-Patanjali Yoga Sutra
Patanjali Yoga Sutra – Kaivalya Pada Mind is not self-illumintive 4.19. Na tatsvabhasam drsyatvat| Na-not Tat-that svabhasam –self-illumined drsyatvat-of perceptibility That chitta is not self-illumined
Purusha knows the mind-Kaivalya Pada-Patanjali Yoga Sutra
Patanjali Yoga Sutra – Kaivalya Pada Purusha knows the mind 4.18. Sada jnatascittavrttayastatprabhoh purusasyaparinnamitvat| Sada-always Jnatah-are known Chittavrttayah-modifications of mind Tatprabhoh-on its master Purusasya-of the
What is perception ? – Kaivalya Pada-Patanjali Yoga Sutra
Patanjali Yoga Sutra – Kaivalya Pada What is perception ? 4.15. Vastusamye chittabhedattayovibhaktah panthah| Vastusamye-by sameness of the object Chittabhedat-by the difference of the mind
Potentiality of object- Kaivalya Pada-Patanjali Yoga Sutra
Patanjali Yoga Sutra – Kaivalya Pada Potentiality of object 4.14. Parinamaikatvadvastutattvam| Parinama-transformation Ekatvat-due to oneness Vastu-object Tattvam-the essence The potential of the object is due
Dominance of action or karma- Kaivalya Pada – Patanjali Yoga Sutra
Patanjali Yoga Sutra – Kaivalya Pada – Dominance of action or karma 4.7. Karmasuklakrsnam yoginastrividhamitaresam| Karma-action Asukla-not white Akrsnam-not black Yoginah-of the yogis Trividham-threefold Itaresam-of
Vanishing of impressions-Kaivalya Pada -Patanjali Yoga Sutra
Patanjali Yoga Sutra – Kaivalya Pada Vanishing of impressions 4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah| Hetu-cause Phala-effect Asraya-support Alambanaih-object Sangrhitatvat-because of being bound together Esam-of these Abhave-on
Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions
Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions 4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat| Jati-class of birth Desa-place Kala-time Vyavahitanam-separated Api-even Anantaryam-sequence Smrtisamskarayoh-of memory and impressions Ekarupatvat-because

Heart, Arteries & Veins Forms the Circulatory System
The Heart, Arteries & Veins Forms the Circulatory System: The heart pumps blood into arteries. The arteries divide and subdivide and finally end in capillaries.

Measurement of blood pressure
Measurement of blood pressure: Blood pressure is usually measured by an instrument called sphygmomanometer; it consists of a mercury manometer. Cuff and hand pump. The

Unmani Avastha State
Unmani Avastha Tare jyotishi samyojya kimchidunnamayed bhruvau/ Purvayogam mano yunjannunmanikarakah kshanat// Fix the gaze on the tip of the nose and raise the eyebrows a

Sound-Shakti – Dissolves in Consciousness
Sound is shakti and dissolves in consciousness Yatkinchin nadarupena sruyate saktireva sa / Yas tattvanto nirakarah sa eva paramesvarah// Whatever is heard of the nature

Shambhavi Mudra (eyebrow center gazing)
Shambhavi Mudra (eyebrow center gazing) Shambhavi mudra (eyebrow center gazing) internalizes pranic flow and mind – If the Hatha Yogi remains with the chitta and

Prana and Mind
Prana and mind are controlled through each other Pavano badhyate yena manastenaiva badhyate / Manascha badhyate yena pavanastena badhyate// Through controlling the prana, thought is

Parichaya Avastha (stage of increase)
Parichaya Avastha (stage of increase) Stage of increase – Sound of the drum, perfection or siddhi. Imbalance of the three humors or doshas, pain, old

Main bones of the human skeleton
The main bones of the human skeleton are: The Skull – Cranium, Mandible, and Maxilla Shoulder girdle – clavicle and scapula Arm – humerus, radius,

Nishpatti Avastha (state of consummation)
Nishpatti Avastha (state of consummation) Nishpatti avastha or state of consummation – Rudra granthi is pierced, the fire of prana flows to the place of

Nada anusandhana – exploration of sound “OM”
Nada anusandhana – exploration of sound “OM” Nada anusandhana – exploration of sound”OM” – Closing the ears, nose and mouth, a clear, clear sound is

Mind dissolves in Samadhi
Mind dissolves in Samadhi Mind dissolves in Samadhi – As camphor burnt in fire, and salt mix in the sea, in samadhi mind dissolves into

Mind – Senses, Prana – Mind, Nada – Prana
Mind – Senses, Prana – Mind, Nada – Prana Indriyanam mano natho manonathastu marutah/ Marutasya layo nathah sa layo nadamasritah// Mind is the controller of

Manonmani (consciousness without mind) State
Manonmani (consciousness without mind) State Manonmani (consciousness without mind) – Manonmani is obtained when prana flows in sushumna nadi Sushumnavahini prane siddhyatyeva manonmani/ Anyatha tvitarabhyasah

Kundalini at Brahmarandhra Nadi
Kundalini is to be blocked at Brahmarandhra Nadi The ultimate union and samadhi happens at sahasrara chakra. This location is at the crown of the

Karma annihilated when prana flows Sushumna Nadi
Karmas get annihilated when prana flows in Sushumna Nadi All Karmas(actions) get annihilated when prana flows in sushumna nadi, mind remain in complete shoonya(void).

Hatha Yogi – Ghata Avastha (vessel stage)
Ghata Avastha (vessel stage) Ghata avastha (vessel stage) – Vishnu granthi is pierced the greatest bliss is revealed. Then from that emptiness the sound of

Prana and Mind end in Samadhi state
Ending of Prana and Mind in Samadhi state Ending of Prana and Mind in Samadhi state – Activities of prana is annihilated, then mind is

Factors affecting blood pressure
Factors affecting blood pressure: Blood volume. Cardiac output Peripheral resistance. The elasticity of blood vessels. The diameter of the lumen of blood vessels. The viscosity

Concentration on nada erase ‘bad karma’
Concentration on nada burns ‘bad karma’ Concentration on nada burns ‘bad karma’ – Bad karma’(sin) is destroyed by constant concentration on nada. The finite mind

Chitta: Vasana and Prana
Chitta has two qualities: vasana and prana Hetudvayam tu chittasya vasana cha samiranah / Tayorvinashta ekasmintau dvavapi vinasyatah// Chitta has two qualities, vasana and prana.

Hatha Yogi-Arambha Avastha (beginning stage)
Arambha Avastha (beginning stage) Arambha avastha (beginning stage) – When the Hatha Yogi experiences arambha in the void of the heart, his body becomes lustrous

Disorders of Heart
Disorders of Heart Cardiac failure: It’s a condition in which the myocardium of ventricle is unable to maintain sufficient circulation of blood to meet the

Vipareeta Karani Mudra (reversing attitude)
Vipareeta Karani Mudra (reversing attitude) Urdhvanabheradhastalorurdhvam bhanuradhah sasi / Karani viparitakha ghuruvakyena labhyate// With the navel region above and the palate below, the sun is

Uddiyana Bandha (Abdominal Retraction Lock)
Uddiyana Bandha (Abdominal Retraction Lock) Atha uddiyanabandhah Baddho yena sushumnayam pranastuddiyate yatah/ Tasmad uddiyanakhyoa yam yoghibhih samudahrtah/ Uddiyana bandha is so-called by the yogis because

Moola Bandha(perineum/cervix retraction lock)
Moola Bandha(perineum/cervix retraction lock) Atha mulabandhah Parshnibhaghena sampidya yonim akunchayed ghudam/ Apanam urdhvam akrshya mulabandho abhidhiyate// Pressing the perineum/vagina with the heel and contracting the

Maha Vedha Mudra (Great Piercing Attitude)
Maha Vedha Mudra (Great Piercing Attitude) Atha mahavedhah Mahabandhasthito yogi krtva purakam ekadhih/ Vayunam ghatimavrtya nibhrtam kanthamudraya// The Hatha Yogi, in the position of Maha

Maha Mudra (The Great Attitude)
Maha Mudra (The Great Attitude) Padamulena vamena yonim sampidya dakshinam/ Prasaritam padam krtva karabhyam dharayeddrdham//(Chapter -3, Verse 10). Press the left heel into the perineum

Maha Bandha (Great Lock)
Maha Bandha (Great Lock) Parshnim vamasya padasya yonisthane niyojayet/ Vamorupari samsthapya dakshinam charanam tatha// Press the heel of the left foot in the perineum or

Jalandhara Bandha (throat lock)
Jalandhara Bandha (throat lock) Atha jalandharabandhah Kanthamakunchya hrdaye sthapayechchibukam drdham/ Bandho jalandharakhyoayam jaramrtyuvinasakah// Contracting the throat by bringing the chin to the chest sternum bone

What is life and death; the functions of five Vayus
What is life and death? What is life and death; the functions of five Vayus Yavad vayuh sthito dehe tavaj jivanam uchyate / Maranam

Times and duration of Pranayama practice
Times and duration of Pranayama practice Times and duration of practice – Early morning, midday, evening and midnight, holding is step by step held up
