Benefits of following Non-Violence 2.35. Ahimsapratisthayam tatsamnidhau vairatyagah| Ahiàsa-non-violence Pratisthayam-on being firmly established Tatsamnidhau-in its vicinity Vaira-hostility Tyagah-abandonment Those who following strongly ahimsa path, there
Benefits of by mastery over Asana 2.48. Tato dvandvanabhighatah| Tatah-from that Dvandva-pair of opposites Anabhighatah-no impact Thereby the pairs of opposites stop to have any
Benefits of being cleanliness 2.40. Saucat svanga jugupsa parairasaàsargah| Saucat-from clealiness Svanga-one own body Jugupsa-indifference Paraih-with others Asamsargah-non-attachment By being cleanliness there comes indifference towards
Benefits of being celibacy 2.38. Brahmacharyapratisthayam viryalabhah| Brahmacharya-sexual abstinence Pratisthayam-on being firmly established Virya-indomitable courage Labhah-gain By following celibacy, veerya is gained.
Benefits of being contentment 2.42. Santosadanuttamasukhalabhah| Santosad-from contentment Anuttamah-unexcelled Sukha-pleasure Labhah-gain Infinite happiness comes from the practice of contentment.
Benefits of austerities 2.43. Kayendriya siddhirasuddhiksayattapasah| Kaya-the body Indriya-sense organ Siddhi-perfection Asuddhi-impurity Ksayat-destruction Tapasah-by austerities By following austerities, impurities are eradicated and there appears perfection
Benefits of self-study 2.44. Svadhyayadistadevatasamprayogah| Svadhyayat-by self-awareness, self-obsrvation Istadevata-the deity of choice Samprayogah-communion By self-study, union with the desired deity is brought about.
Mastery over the senses by pratyahara 2.55. Tatah paramavasyatendriyanam| Tatah-thereby Parama-highest Vasyate-mastery Indriyanam-of the senses This is the highest state of mastery over the sense
Patanjali Yoga Sutra – Kaivalya Pada Attainment of pure consciousness or kaivalya 4.34. Purusarthasunyanam gunanam pratiprasavah kaivalyam svarupapratistha va chitisakteriti| Purusartha-purpose of the purusha Sunyanam-devoid
Patanjali Yoga Sutra – Kaivalya Pada Confusion of memories 4.21. Chittantaradrsye buddhibuddheratiprasangah smrtisankarascha| Chittantaradrsye-in one mind being cognized by the other Buddhibuddheh-cognition of cognitions Atiprasangah-absurd
Patanjali Yoga Sutra – Kaivalya Pada Limitation of mind 4.20. Ekasamaye chobhayanavadharanam| Ekasamaye-simultaneously Cha-and Ubhaya-both Anavadharanam-non-comprehension And there cannot be the comprehension of both simultaneously.
Patanjali Yoga Sutra – Kaivalya Pada Mind & object 4.16. Na chaika chittatantram vastu tadapramanakam tada kim syat| Na-not Cha-and Eka-one Chitta-mind Tantram-dependent Vastu-object
Patanjali Yoga Sutra – Kaivalya Pada Mind is not self-illumintive 4.19. Na tatsvabhasam drsyatvat| Na-not Tat-that svabhasam –self-illumined drsyatvat-of perceptibility That chitta is not self-illumined
Patanjali Yoga Sutra – Kaivalya Pada Purusha knows the mind 4.18. Sada jnatascittavrttayastatprabhoh purusasyaparinnamitvat| Sada-always Jnatah-are known Chittavrttayah-modifications of mind Tatprabhoh-on its master Purusasya-of the
Patanjali Yoga Sutra – Kaivalya Pada What is perception ? 4.15. Vastusamye chittabhedattayovibhaktah panthah| Vastusamye-by sameness of the object Chittabhedat-by the difference of the mind
Patanjali Yoga Sutra – Kaivalya Pada Potentiality of object 4.14. Parinamaikatvadvastutattvam| Parinama-transformation Ekatvat-due to oneness Vastu-object Tattvam-the essence The potential of the object is due
Patanjali Yoga Sutra – Kaivalya Pada – Dominance of action or karma 4.7. Karmasuklakrsnam yoginastrividhamitaresam| Karma-action Asukla-not white Akrsnam-not black Yoginah-of the yogis Trividham-threefold Itaresam-of
Patanjali Yoga Sutra – Kaivalya Pada Vanishing of impressions 4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah| Hetu-cause Phala-effect Asraya-support Alambanaih-object Sangrhitatvat-because of being bound together Esam-of these Abhave-on
Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions 4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat| Jati-class of birth Desa-place Kala-time Vyavahitanam-separated Api-even Anantaryam-sequence Smrtisamskarayoh-of memory and impressions Ekarupatvat-because
The Heart, Arteries & Veins Forms the Circulatory System: The heart pumps blood into arteries. The arteries divide and subdivide and finally end in capillaries.
Measurement of blood pressure: Blood pressure is usually measured by an instrument called sphygmomanometer; it consists of a mercury manometer. Cuff and hand pump. The
Unmani Avastha Tare jyotishi samyojya kimchidunnamayed bhruvau/ Purvayogam mano yunjannunmanikarakah kshanat// Fix the gaze on the tip of the nose and raise the eyebrows a
Sound is shakti and dissolves in consciousness Yatkinchin nadarupena sruyate saktireva sa / Yas tattvanto nirakarah sa eva paramesvarah// Whatever is heard of the nature
Shambhavi Mudra (eyebrow center gazing) Shambhavi mudra (eyebrow center gazing) internalizes pranic flow and mind – If the Hatha Yogi remains with the chitta and
Prana and mind are controlled through each other Pavano badhyate yena manastenaiva badhyate / Manascha badhyate yena pavanastena badhyate// Through controlling the prana, thought is
Parichaya Avastha (stage of increase) Stage of increase – Sound of the drum, perfection or siddhi. Imbalance of the three humors or doshas, pain, old
The main bones of the human skeleton are: The Skull – Cranium, Mandible, and Maxilla Shoulder girdle – clavicle and scapula Arm – humerus, radius,
Nishpatti Avastha (state of consummation) Nishpatti avastha or state of consummation – Rudra granthi is pierced, the fire of prana flows to the place of
Nada anusandhana – exploration of sound “OM” Nada anusandhana – exploration of sound”OM” – Closing the ears, nose and mouth, a clear, clear sound is
Mind dissolves in Samadhi Mind dissolves in Samadhi – As camphor burnt in fire, and salt mix in the sea, in samadhi mind dissolves into
Mind – Senses, Prana – Mind, Nada – Prana Indriyanam mano natho manonathastu marutah/ Marutasya layo nathah sa layo nadamasritah// Mind is the controller of
Manonmani (consciousness without mind) State Manonmani (consciousness without mind) – Manonmani is obtained when prana flows in sushumna nadi Sushumnavahini prane siddhyatyeva manonmani/ Anyatha tvitarabhyasah
Kundalini is to be blocked at Brahmarandhra Nadi The ultimate union and samadhi happens at sahasrara chakra. This location is at the crown of the
Karmas get annihilated when prana flows in Sushumna Nadi All Karmas(actions) get annihilated when prana flows in sushumna nadi, mind remain in complete shoonya(void).
Ghata Avastha (vessel stage) Ghata avastha (vessel stage) – Vishnu granthi is pierced the greatest bliss is revealed. Then from that emptiness the sound of
Ending of Prana and Mind in Samadhi state Ending of Prana and Mind in Samadhi state – Activities of prana is annihilated, then mind is
Factors affecting blood pressure: Blood volume. Cardiac output Peripheral resistance. The elasticity of blood vessels. The diameter of the lumen of blood vessels. The viscosity
Concentration on nada burns ‘bad karma’ Concentration on nada burns ‘bad karma’ – Bad karma’(sin) is destroyed by constant concentration on nada. The finite mind
Chitta has two qualities: vasana and prana Hetudvayam tu chittasya vasana cha samiranah / Tayorvinashta ekasmintau dvavapi vinasyatah// Chitta has two qualities, vasana and prana.
Arambha Avastha (beginning stage) Arambha avastha (beginning stage) – When the Hatha Yogi experiences arambha in the void of the heart, his body becomes lustrous
