Yoga for Bronchial Asthma
Yoga for Bronchial Asthma It is defined as a chronic inflammatory disorder of the airways, characterized by reversible airflow obstruction causing cough, wheeze, chest tightness and shortness of breath. #Online 200 hour Yoga teacher training Bangalore Causes Allergens Infection Exercise Environment Occupation Drugs Emotion Clinical Features It may be either episodic or chronic Episodic Asthma In this form of the disease the patient has no respiratory symptoms or signs between episodes of asthma. Paroxysms of wheeze and dyspnoea occur at any time and can be of sudden onset. It can be triggered by allergens, exercise or viral infections. Attacks may be mild or severe and may last for hours, days or even weeks #Online 200 hour Yoga teacher training Bangalore Chronic Asthma Chest tightness Wheeze Breathlessness on exertion Spontaneous cough and wheeze during the night and early morning Yogic Practices Surya namaskara Shashakasana Pranamanasana Sarvangasana Suptavajrasana – Ushtrasana Hasta Uttanasana Utthita lolasana Dwikonasana Matsyasana Backward bending asanas Pada hastasana Baddha padmasana. #Yoga teacher training course fees in Bangalore Pranayama Nadishodhana Bhastrika Kapalbhati Deep abdominal breathing at all times. Shatkarma Vastra dhauti Shankhaprakshalana Kunjal Other Yoga nidra Meditation #Yoga teacher training course fees in Bangalore
How does the Asanas work?
How does the Asanas work? Asanas are based on five principles. i) The use of gravity. The inverted postures such as the headstand, shoulder stand and the reverse posture take advantage of gravity to increase the flow of blood to the desired part of the body; in the headstand to the brain, in the shoulder stand to the thyroid gland and in the reverse posture to the gonads (sex glands). ii) Organ massage. The position of the asanas causes a squeezing action on a specific organ or gland, resulting in the stimulation of that part of the body.#Online Yoga teacher training course fees in Bangalore iii) Stretching muscles and ligaments. This causes an increase in blood supply to the muscles and ligaments as well as relaxing them. It also takes pressure of nerves in the area. This stretching is involved in all the asanas, since it has such a beneficial effect on the body. iv) Deep breathing. While holding the yoga posture we breathe slowly and deeply, moving the abdomen only (abdominal or low breathing). This increases the oxygen and prana supply to the target organ or gland, thereby enhancing the effect of the asana v) Concentration. As well as breathing slowly and deeply, we also focus our attention on the target organ or gland. This brings the mind into play, and greatly increases the circulation and prana supply to the organ or gland. This concentration has the second benefit of increasing your general powers of concentration through regular practise. This benefits every aspect of your life. Your mind is less distracted and swayed by external events and you are therefore calmer and worriless. You will be able to solve day-to-day problems better and have more success in whatever activity you undertake. Physical exercise draws the prana out. Asanas send the präëa in and distribution quite evenly throughout the body and different system. Asana are not physical but also spiritual, as they awaken the serpent power that is sleeping in Muladhara cakra. This is the third anga (limb) of the Astanga RajaYoga of Patanjali Maharsi .A particular asana removes the Particular disease. Asanas are not mere physical exercises alone. They are something more than that. They have spiritual basis. They help a long way in controlling senses, mind and body. Body nerve and muscle are purified (Sarira suddhi and Nadi suddhi) Kundalini is awakened which gives bliss, power and yogi Samadhi to the aspirant. If you develop vairagya, if you subdue your Indriya and sense enjoyment and pleasures of this world as dung and poison, as they are mixed with pain, sin, fear craving, miseries, disease old age and death, nothing can tempt you in this world. You will have eternal peace and infinite bliss. Asana and pranayama remove all sorts of disease, improve the health energetic digestion invigorate the nerves ,strength the Sushumna nadi, remove the Rajas and awaken the kundalini . Practise of asana and Pranayama bestows good health and steady mind. #Online Yoga Classes in India Yogasanas are preliminarily aimed at improving the muscle tone (suppleness) and plasticity of muscle. Activation of muscles that were once important at earlier evolutionary stages but have fallen into disuse. Priming or activating the stretch reflexes at the level of spinal cord. The neural impulses that are needed to travel up the long sensory pathways up to the Ascending Reticular Formation (Mid Brain) and further through the thalamus to the cortex are rendered unnecessary. This automatically helps in maintaining the alpha activity of the E.E.G (Electrical recording of the brain waves) but not disturbing the thalamo-cortical pathways. This ensures a resting, relaxed activating at the level of cerebral cortex. The static comfortable postures accompanied by a meditative state, dampens the inflow of sensory impulses to the brain. This is turn, causes less stimulation to the “Emotional Brain” (Limbic Cortex Hypothalamus Anterior Pituitary and their connections with the Adrenal gland). Therefore, there are less visceral gland disturbance to disturb attention and connection. Further more, the reduction of sensory input creates a reciprocal chain, relaxing the muscles. Inhabitation of synapses at the neuromuscular junctions, in turn, reduces the sensory input further. #Personal yoga classes online India Yoga is smooth graded exercises from the initial posture to the final state. This is achieved not through forcible jerky movements, but slow dynamic movements, gradually changing over to static states. The risk of over-straining or injuring muscle and ligaments are therefore reduced considerably. There is a little fatigue induced by asana. The exercises are done with a few warm-up movements to improve the blood flow and body temperature and are done in a sequence that keeps at the rest certain group of muscles in one asana and brings into active operation the opposite group of muscles in the next asana For exercise, involves the flexion of the spine, those that extend the spinal muscle in the (Bhujangasana s) follow (Paschimottanasana). This is called “Vinyasa” the exercises are interspersed with the restful periods (Shavasana) to eliminate the factor of fatigue. #Personal yoga trainer at home Bangalore The Yogasanas do not require the use of extra calories 2-14 calories per minute (and a man resting on the bed spend about 0.9 to 1 calorie per minute). Yogasanas require only about 0.8 to 3 calories per minutes. The sequential activation of agnostic (Prime mover muscles) and antagonistic (counter acting muscles) assures the muscles suppleness, plasticity and phenomenon of reciprocal inhabitation remains in efficient operation. Yoga asanas improves the perceptual motor co-ordination. In yoga asanas, breathing is kept as natural as possible and at any state of hyperventilation, the person is supposed to restore to relax the postures (Shavasanas). This is the major reason why fatigue is not a usual phenomenon and the expenditure of calories remains minimum. That allows yoga asanas to be induced soon after a common illness or some asanas can be performed during early in the pregnancy. Asanas are primarily involved with postural reflexes which are mediated by sub cortical centers-medulla, pons, cerebellum, basal ganglia
Balanced diet
Balanced diet Definition Balanced diet is a diet which contains all the nutrients in the right amounts as required by an individual’s body needs. #Online Yoga certification Course Bangalore The general rules for making the diet balanced are Each meal should contain some food rich in proteins like pulses, egg, meat, cheese etc. Each meal should contain plenty of fruits and vegetables which are good sources of some vitamins and minerals. Food rich in energy should be eaten in amounts which will satisfy appetite and maintain correct body weight.#Best yoga blogs in India Carbohydrates These supply 70-80% of the total energy requirement of our body. They contain carbon, hydrogen and oxygen. Each of carbohydrate provides 4 kcals. They are a quick source of energy after digestion of starch and sugar. It is absorbed through the walls of the intestine and finally carried to the liver where it may be utilized or stored as glycogen. Any excess is converted to fat and stored. Hence carbohydrates and fats are referred to as ‘protein spares” Fats It contains carbon hydrogen and oxygen are made up of fatty acids. They serve as insulators, padding around organs, acts as protein spares, carries of Vit, A, D, E & K., increase palatability and satiety value of foods. Each g of fat provides 9 kcals. Sources may be animal (ghee, butter, fish oils) or vegetable (Groundnut, gingerly, mustard, safflower etc) Proteins It forms the structure of muscles, cartilage, bones, skin and also is found in tissues and body fluids Each of protein provides 4 kcals. #Online Yoga Teacher Training Bangalore Sources Animal – eggs, Milk, meat, fish Plant – Cereals, pulses, nuts, beans, oilseeds. Protein Requirement On an average protein requirement is i g / kg of body weight of a person. This requirement may increase after tissue loss or destruction to rebuild new tissue. An increase in protein requirement is seen in Growing phase of infants and childhood Destruction of tissues due to burns Wasting diseases During wound healing Pregnancy and lactation. Minerals: are trace elements which are required in small amounts but are essential for life minerals are inorganic substances like Na, K, Ca, P, Mg, I2, Fe, cobalt, cu etc Na, k help in regulation of body fluids and acid base balance. Ca helps in maintenance of neural. Muscular excitability blood coagulation and bone formation. P helps in tissue metabolism and bone formation I2, is required for synthesis of thyroid hormones Fe is incorporated in Hb molecule. Cobalt helps in formation of vit B12. Vitamins are essential for regulating the body process. They are broadly classified into two groups : Fat soluble vitamins such as A, D, E, K. Water soluble vitamins such as Vit, B1, B2, B6, Niacin, panthothenic acid, folic acid, cyanocobalamin, vitc etc. etables: Aim for a range of colors and types. They provide essential vitamins, minerals, and fiber. Proteins: Include sources like lean meats, fish, eggs, beans, and nuts. Proteins are crucial for muscle repair and growth. Grains: Choose whole grains such as brown rice, whole wheat bread, and oats. They offer fiber and important nutrients. Dairy or Alternatives: Opt for low-fat or non-dairy options like almond milk or soy milk. They provide calcium and vitamin D. Fats: Focus on healthy fats from sources like avocados, nuts, seeds, and olive oil. Limit saturated and trans fats. Staying hydrated is also key, so drink plenty of water throughout the day. If you have specific dietary needs or health conditions, it’s a good idea to consult with a nutritionist or healthcare provider. #Online Yoga teacher training course fees in Bangalore
Ayurvedic Body Types and Asana Practices
Ayurvedic Body Types and Asana Practices To understand the Asanas potentials of different people we will want to look at them according to their doşic body types #200 hour Yoga teacher training certificate course in Bangalore VATA BODY TYPE: Vata types have thin and long bones that are often weak or brittle. They have low body weight and poor development of the muscles, but a good deal of speed and flexibility. Their bone structure makes them good at bending and stretching, particularly of the arms and legs, when they are young. As they get older, however, the dry quality of Vata increases and causes them to lose mobility if they don’t exercise regularly. A gentle, slow asanas practise evenly balanced on both sides of the body is the ideal exercise for Vata types. Vatas are most in need of asanas practise because asanas alleviates accumulated Vata from the back and the bones, where it easily gets lodged. Vata diseases begin with an accumulation of the downward moving air (Apana Vayu) in the colon, which gets transferred to the bones, where it causes bone and joint problems. Väta benefits from the massaging action of asanas on the muscles and joints, which releases nervous tension and balances out the system. #Yoga course Bangalore PITTA BODY TYPE: Pitta types have an average build with a generally good development of the muscles and a looseness of the joints, which gives them a fair amount of flexibility. They are good at asanas practise but cannot do some of the more exotic poses that Vatas can do because of the shorter bones that they usually have. Pittas benefit from asanas practise to cool down the head, cool the blood, calm the heart and relieve tension. For example, Pittas tend to hypertension because of their fiery temperament that keeps them always wanting to succeed or to win. KAPHA BODY TYPE: Kaphas are typically short and stocky, gaining weight easily. With their short and thick bones they lack flexibility and cannot do poses that require flexibility like the lotus pose. Yet they are sturdy and strong and have the best endurance of the different types. Kaphas need movement and stimulation to counter their tendency to complacency and inertia. They are good at keeping a practise going for longer periods of time, once they get it going in the first place. The Ayurvedic way of performing asanas. #Yoga course Bangalore Ayurveda does not look upon asanas as fixed forms that by them either decrease or increase the dosas. It views them as vehicles for energy that can be used to help balance the dosas, if used correctly. The same is true of the ayurvedic view of food. While Ayurveda says that foods of certain tastes are more likely to increase or decrease specific dosas, it also says that we need some degree of all the tastes. So too, we need to do all the major types of asanas to some degree. It is the degree and exertion that varies with the dosas type. Each person requires a full range of exercise that deals with the full range of motion in the body. #Yoga teacher training certification course near me
Yoga for Arthritis
Yoga for Arthritis Inflammation of Joints is Called Arthritis Rheumatoid Arthritis It is a chronic inflammatory joint disease. In its typical form RA is a symmetrical, destructive and deforming polyarthrits affecting small and large synovial joints associated with systemic disturbance. #200 hour Yoga teacher training certificate course in Bangalore Causes Hereditary Infection Physical and emotional stress Injury #Yoga teacher training certification course near me Clinical Features Onset is insidious Joint pain Stiffness and symmetrical swelling of a number of peripheral joints Fever Weightless Profound fatigue Osteo Arthritis Degenerative joint disease which usually occur in the old age. It results from structural changes in the articular cartilage in the joints. Possible causes include Malnutrition glandular insufficiency, and continuous physical stress. #Best yoga teacher training certification courses in Bangalore Symptoms Pain and stiffness in the joints Watery eyes Dry neck leg Cramps #Yoga teacher training certificate course fees in Bangalore Yogic Practices Sithilikarna Vyayama (Loosening Exercises) Passive rotation of toes Toe Bending Ankle Bending Ankle Rotation Knee bending Knee Rotation Half butterfly Full Butterfly Waist Rotation Wrist Rotation Shoulder Rotation Neck Bending Neck Rotation #online live 200 hour yoga teacher training certificate course Bangalore Sukshma Vyayama (Strengthening Exercises) Manibandha sakti vikasak (Waist) Kara Tala Saktivikasak (Palms) Anguli Saktivikasak (Finger) Kaphoni Sakti vikasak (Elbows) Bhujabandha sakti vikasak (Arms) Kati saktivikasak (Back) Jangha sakti vikasak (Thighs) Pindali Saktividkasak (Calf) Pranayama Kapalabhati Nadishuddhi Brahmari Shatkarma Neti Kunjal Others Yoga nidra Meditation #Online 200 hour Yoga teacher training Bangalore
Asana Physiology and it’s benefits
Asana Physiology and it’s benefits Physiology of Sitting Asanas All sitting asanas bring elasticity to the hips, knees, ankles, and muscles of the groin. These poses remove tension and hardness in the diaphragm and throat. Making breathing smoother and easier. They keep the spine steady, pacifying the mind and stretching the muscles of the heart. Blood circulation increases to all parts of the body. #Online 200 hour Yoga teacher training Bangalore Physiology of standing asanas Standing asanas strengthen the leg muscles and joints, and increase the suppleness and strength of the spine. Owing to their rotational and flexing movements, the spinal muscles and inter-vertebral joints are kept mobile and well aligned. The arteries of the legs are stretched, increasing the blood supply to the lower limbs, and preventing thrombosis in the call muscles. These asanas also tone the cardio-vascular system. The lateral wall of the heart is fully stretched, increasing the supply of fresh blood to the heart. Forward bends In forward bends, the abdominal organs are compressed. This has a unique effect on the nervous system as these organs relax, the frontal brain is cooled, and the flow of blood to the entire brain is regulated. Stress is removed from the organs of perception and the senses relax. The adrenal glands are also soothed and function more efficiently. Since the body is in a horizontal position in forward bends. The heart is relieved of the strain of pumping blood against gravity and blood circulates through all parts of the body easily. Forward bends also strengthen the Para spinal muscles, inter-vertebral joints and ligaments. #Online 300 hour Yoga teacher training Bangalore Physiology & benefits of Twisting Asanas These asanas teach us the importance of a healthy spine and inner body in twists, the pelvic and abdominal organs are squeezed and flushed with blood. They improve the suppleness of the diaphragam, relieve spinal, hip and groin disorders. The spine also becomes more supple and this improves the flow of blood to the spinal nerves and increases energy levels. Physiology & benefits of backward bending Asanas All back bends stimulate the central nervous system and increase its ability to bear stress. They help to relieve and prevent headaches, hypertension and nervous exhaustion. These asanas stimulate and energize the body and are invaluable to people suffering from depression. In Urdhva Dhanurasana and Vipartia Dandasana the liver and spleen are fully stretched and can therefore function more effectively. Yoga can help solve the problems of any receptive individual, whether these problems be of a physical, mental or spiritual nature and thereby, eventually, also help solve the problems of a group, society and even a nation. #Online 200 hour Yoga teacher training Bangalore
Trataka (Gazing)
Trataka (Gazing) Gaze steadily without winking with a concentrated mind at any small object, until tears begin to flow. By this practice all diseases of the eye are removed. Unsteadiness of the mind vanishes. Sambhavi Siddhi is obtained. Will-power is developed. Clairvoyance is induced. #Online 200 hour Yoga teacher training Bangalore
Nauli
Nauli This is abdominal churning with the help of rectus muscle of the abdomen. Bend the head down. Isolate the rectus muscle and turn it from right to left and from left to right. This removes constipation, increases the digestive fire and destroys all intestinal disorders. #Online 200 hour Yoga teacher training Bangalore
Basti(Yoga course in India)
Basti This can be practised with or without a bamboo tube. But it is better to have a bamboo-tube. Sit in a tub of water covering your navel. Assume the posture Utkatasana by resting your body on the forepart of your feet, the heels pressing against the posteriors. Take a small bamboo-tube 6 fingers long and insert 4 fingers of its length into the anus after lubricating the tube with vaseline or soap or castor oil. Then contract the anus. Draw the water into the bowels slowly. Shake well the water within the bowels and then expel the water outside. It is known as Jala-Basti. It cures Pleeha, urinary disorders, Gulma, myalga, dropsy, disorders of digestion, diseases of the spleen andbowels, diseases arising from the excess of wind, bile and phlegm. This Kriya should be done in the morning when the stomach is empty. Drink a cup of milk or take your meals when the Kriya is over. This Kriya can be practised while standing in a river. There is another way of doing Basti without the help of water. It is called Sthula-Basti. Sit in Paschimottanasana on the ground and churn the abdominal and intestinal portions slowly with a downward motion. Contract the sphincter muscles. This removes constipation and all the abdominal disorders. #Online 300 hour Yoga teacher training Bangalore
Vastra Dhouti
Vastra Dhouti Practice Catch one end of the cloth with both hands and start swallowing slowly with deep awareness and ease. Drink sips of water along with the cloth if it does not move on smoothly. Make sure that about 20 – 25cms of the cloth is left outside towards the end. After completing, wait for a few seconds, churn the abdomen by movement or agnisara twisting. Lean forward and start pulling out the cloth slowly with ease and relaxation. If the cloth is not coming out easily, wait, take a deep breath and relax, drink a few sips of water and then continue. #Online 300 hour Yoga teacher training Bangalore
Vaman Dhauti
Vaman Dhauti Practice Drink about one and a half liters of lukewarm saline water (about 1% saline) as quickly as you can until you feel like vomiting it out. Churn the stomach by twisting exercises. Stand with feet apart at shoulder width and bend the trunk forward forming an angle of about 80 degrees to the body. Now with the help of the middle three fingers of the right hand, tickle the back of the throat to vomit out (vaman) all the water. Repeat the process of tickling the throat until no more water comes out which may mean that all water has been vomited . With continued practice one can stimulate the vomiting sensation and vomit out the water without using the fingers at the throat. Relax completely in savasana for about 15 to 20 minutes. Have a bland breakfast after about half an hour. #Online 300 hour Yoga teacher training Bangalore
Kapalabhati (frontal brain cleansing breath)
Kapalabhati (frontal brain cleansing breath) Practice Practice rapid breathing with active and forceful exhalation and passive inhalation. During each exhalation, blast out the air by vigorous flapping movements of the abdomen in quick succession. Inhale passively by relaxing the abdominal muscles at the end of each exhalation. Repeat the exhalation as quickly as possible at the rate of 60 strokes per minute. At the end of one minute, stop the practice. Now observe an automatic suspension of breath. In fact, there will be no urge for breathing for a few seconds. Simultaneously the mind may experience a deep state of silence. Enjoy this state of deep rest and freshness. Wait until the breathing comes back to normal. Benefits Brain cells are invigorated. It brings brightness to the face with regular practice. It balances and strengthens the nervous system. It removes the drowsiness from the body. It provides a nice massage to all the abdominal organs. People with digestive problems are highly benefited. It cleanses the lungs and also the entire respiratory tract. It is good for asthmatics and for other respiratory disorders. #Online 300 hour Yoga teacher training Bangalore
Jala Neti (Cleaning the nasal passage
Jala Neti (Cleaning the nasal passage) Practice Add about half a teaspoon of salt to a neti pot full of sterile lukewarm water. Stand with the legs apart. Hold the neti pot in your right hand. Insert the nozzle of the Neti pot into the right nostril. Keep the mouth open and breathe freely through the mouth. Tilt the head first slightly backwards, then forwards and sidewards to the left so that the water from the pot enters the right nostril and comes out through the left by gravity. Allow the flow till the pot is empty. Repeat the same on the left side. To clear the nasal passages of the remaining water, blow out the water by active exhalation through alternate nostrils as in Kapalabhati. #Prenatal, Mudra Therapy, Yoga Chanting & Meditation certificate Course Benefits It helps to clear nasal passages. Removes cold, hypersensitivity, headache, sinusitis, bronchitis and stimulates olfactory nerves. #200 hour Yoga teacher training certificate course in Bangalore
Sutra Neti
Sutra Neti Practice Insert the blunt end of a thin soft rubber catheter horizontally into the right nostril. Gently push it along the floor of the nose until the tip is felt in the back of the throat. Insert the right index and the middle finger through the mouth arid catch the tip of the catheter at the back of the throat. Pull it out through the mouth and gently massage the nasal passage by catching the two ends of the tube. Remove the catheter through the nose. Repeat on the left side. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore Benefits Clear the nose and pharynx. Tremendous will power increases in process of catheter insertion. Desensitizes to dust pollution etc. in nasal allergy patients. #Prenatal, Mudra Therapy, Yoga Chanting & Meditation certificate Course
Maha Bandha – Great lock
Maha Bandha – Great lock (Bestower of great siddhis) Practice: Sit in siddha or padmasana with the palms pressing on the knees. The spine should be straight. Breathe in slowly and deeply through the nose. Exhale forcefully and completely through the mouth. Hold the breath outside. Sequentially perform Jalandhara, Uddiyana and Moola Bandha at end. Inhale slowly when the head is upright. This is one round. #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course Benefits: Maha Bandha gives the benefits of all three bandhas. It affects the hormonal secretions of the pineal gland and regulates the entire endocrine system. The decaying, cell of the body is rejuvenated. It soothes anger and introverts the mind prior to meditation. It leads to the merge of prana, apana and samana in agni mandala, which is the culmination of all pranayamas. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore
Mula Bandha – Perennial/ cervix retraction lock
Mula Bandha – Perennial/ cervix retraction lock, when engaged, prevents apana escaping from the lower body and draws it up to unite with prana. Practice Sit in a comfortable meditative pose, preferably siddhasana. Close the eyes, make sure the body is completely relaxed and the spine is erect. For men, the area just inside the perineum has to be contracted, so it is best to concentrate on this area for a few minutes. Women should concentrate on the cervix, as it is the cervix and vaginal muscles which have to be contracted. After a few minutes of concentration, start to gradually contract and release the muscles of the perineum/cervix. Contraction should last for a few seconds. Keep the breath normal. Prepare as above. Contract the muscles of the perineum/cervix and hold. Hold the contraction for till you feel comfortable, then release. Practice five times. Start off with a gentle or partial contraction. Contract just a little and hold without releasing. Then contract a little more. Continue like this, gradually increasing the tension and contraction ten times until full contraction is reached. Hold the full contraction for few seconds and try to breathe normally. #Yoga, Anatomy, Physiology, Kinesiology and Bio-Mechanism Yoga Teacher Training certificate Course Benefits Mula bandha is the force or energy created by lifting the pelvic floor and controlling the breath. It is the root lock and calls the fire within that causes everything to come alive, to move. Mula bandha increases flexibility and stimulates heat. By contracting the perineum and drawing the energy up from the base of the spine, one can intensify and direct the life energy, cultivating a sense of heightened awareness and increasing vitality. Mula bandha ignites the flame of kundalini (cosmic energy), the serpent power. By bringing awareness to the core of the body, mula bandha helps prevent injury. It guides you to move from your center, grounding you so you can become light and fluid in your yoga practice. #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course
Uddiyana Bandha – Abdominal retraction lock
Uddiyana Bandha – Abdominal retraction lock which forces prana up the shushumna nadi. Practice Stand with feet about two feet apart. Bend the knees slightly and rest the hands above the knees, with the thumbs facing inwards and the fingers outwards. The spine must remain straight, not curved; the head should be kept up and eyes open. Inhale deeply through the nose, then exhale quickly through slightly pursed lips, but don’t be forceful. Having fully exhaled, bring the chin to the chest ( jalandhara bandha), raising the shoulders. Pull the abdomen and stomach inward toward the spine and up. Hold for a few seconds. Before inhaling, relax the stomach and abdomen, raise the head and stand straight. Then inhale through the nose slowly and with control. Before repeating another round, breathe normally for a minute or two. Start with three rounds and over a period of a few months increase to more rounds.#Best yoga teacher training certification courses in Bangalore Sit in a comfortable cross-legged position ( padmasana, siddhasana or sukhasana, depending on your flexibility). Sit on a cushion so that the buttocks are raised. Keep the palms of the hands on the knees and the spinal cord upright and straight. Eyes may be open or closed. Begin as above, practicing three to ten rounds, concentrating on the natural breath for a minute or two between rounds.#Yoga teacher training certificate course fees in Bangalore Stand up and experiment moving from the middle of your body, try walking as if there is a string attached to your navel pulling you forward. Practice the bandhas at different times during the day. Notice the effect on your energy level. 5.Notice any fears that arise when you’re practicing the bandhas. Connect the breath, mula bandha, and uddiyana bandha, and try to relax while maintaining the locks. Benefits #Best100/200/300/500 hour yoga teacher training India Movement of shakti in the body is described as a bird. Shakti is the personification of the feminine form of the Divine. Through the practice of the flying bandha, the great bird (Shakti) flies upward with ease, further directing the flow of prana toward higher states of consciousness. By contracting the lower abdomen and pulling it inward and upward, toward the spine, a powerful toning effect and internal strengthening occurs. This lifting helps push up the diaphragm and expel the breath. Uddiyana bandha, the abdominal lock, also eliminates strain by helping to control the breath. Control of the breath controls consciousness. Bandhas are a means of extending control over the breath and thus are a means to extend our access to consciousness. #Yoga, Anatomy, Physiology, Kinesiology and Bio-Mechanism Yoga Teacher Training certificate Course
Jalandhara Bandha – Throat lock
Jalandhara Bandha – Throat lock which prevents prana from escaping the upper body. Practice Jalandhara bandha Sit comfortably in siddhasana or padmasana). Place the palms of the hands on the knees and allow the whole body to relax. Inhale slowly and deeply through the nose and retain the breath. Lower the chin so that it touches the collarbone. At the same time, straighten the elbows and raise the shoulders. Hold the breath and the position for as long as comfortable. Then release jalandhara bandha by slowly raising the head and relaxing the shoulders. Exhale in a very slow, controlled manner. Practice five rounds, breathing normally for a few minutes between each round. Then practice five rounds with external retention (exhale and hold). Visualize the throat as a net that captures the breath as it comes up. Notice when the chin is tucked how easy it is to see your navel. Pay attention to the opening of your throat while simultaneously locking the chin. Link all the bandhas and follow the flow of breath unobstructed while maintaining the locks in the body. Notice any change in energy level or effects on your thoughts. #Yoga teacher training certification course near me Benefits Jalandhara bandha is the water pipe lock. It binds the network of subtle energy channels. Engaging Jalandhara bandha is useful for alleviating diseases of the throat. It also improves the quantum of prana in the thoracic region. By pressing the chin to the chest, prana is captured, preventing it from escaping the upper body. Many major nerve fibers pass through the neck; when jalandhara bandha is performed it exerts pressure on them and the flow of nervous impulses to the brain is restricted. These impulses collect in the cervical plexus, and when the bandha is released they flood into the brain. The force of these impulses helps to activate higher centers in the brain, those that function with creativity and intellect. #Best yoga teacher training certification courses in Bangalore
Patanjali Yoga Sutra – Kaivalya Pada: Potentiality of object
Patanjali Yoga Sutra – Kaivalya Pada: Potentiality of object 4.14. Parinamaikatvadvastutattvam| Parinama-transformation Ekatvat-due to oneness Vastu-object Tattvam-the essence The potential of the object is due to the uniqueness of transformation of the gunas. Patanjali Yoga Sutra – Kaivalya Pada #Online yoga classes India What is perception ? 4.15. Vastusamye chittabhedattayovibhaktah panthah| Vastusamye-by sameness of the object Chittabhedat-by the difference of the mind Tayoh-of these two vibhaktah –separate panthah-path of manifestation Because of the sameness of object and difference of mind their ways are different. #Online Yoga teacher training certification course near me Patanjali Yoga Sutra – Kaivalya Pada Mind & object 4.16. Na chaika chittatantram vastu tadapramanakam tada kim syat| Na-not Cha-and Eka-one Chitta-mind Tantram-dependent Vastu-object Tat-that Apramanakam-non-cognized Tada-then Kim-what Syat-would happen The object of perception is not dependent on the chitta, what would happen to the object of perception when the medium of cognition is not there?. #Online Yoga teacher training certification course near me Patanjali Yoga Sutra – Kaivalya Pada Reflection of object 4.17. Taduparagapeksitvachchittasya vastu jnatajnatam| Taduparaga-the reflection of the object in chitta Apeksitvat-because of necessity Chittasya-of the mind Vastu-object Jnata-known Ajnatam-unknown The mind needs the reflection of the objects for its cognition. Patanjali Yoga Sutra – Kaivalya Pada Purusha knows the mind 4.18. Sada jnatascittavrttayastatprabhoh purusasyaparinnamitvat| Sada-always Jnatah-are known Chittavrttayah-modifications of mind Tatprabhoh-on its master Purusasya-of the purusha Aparinamitvat-due to changelessness Purusha, the master of chitta, is chnageless, therefre, he always knows the modifications of the mind. #Online Yoga teacher training certification course near me Patanjali Yoga Sutra – Kaivalya Pada Mind is not self-illumintive 4.19. Na tatsvabhasam drsyatvat| Na-not Tat-that svabhasam –self-illumined drsyatvat-of perceptibility That chitta is not self-illumined because it is the subject of knowledge and perception. Patanjali Yoga Sutra – Kaivalya Pada Limitation of mind 4.20. Ekasamaye chobhayanavadharanam| Ekasamaye-simultaneously Cha-and Ubhaya-both Anavadharanam-non-comprehension And there cannot be the comprehension of both simultaneously. Patanjali Yoga Sutra – Kaivalya Pada Confusion of memories 4.21. Chittantaradrsye buddhibuddheratiprasangah smrtisankarascha| Chittantaradrsye-in one mind being cognized by the other Buddhibuddheh-cognition of cognitions Atiprasangah-absurd superfluity Smrti-memory Sankarah-confusion Cha-and If cognition by one mind of th eother be accepted, then there will be cognition of cognitions leading to absurdity and confusion of memory. Patanjali Yoga Sutra – Kaivalya Pada Attainment of pure consciousness or kaivalya 4.34. Purusarthasunyanam gunanam pratiprasavah kaivalyam svarupapratistha va chitisakteriti| Purusartha-purpose of the purusha Sunyanam-devoid of Gunanam-of the gunas Pratiprasavah-involution Kaivalyam-liberation Svarupa-ones own nature Pratistha-establishment Va-or Chitisakteh-purusah Iti-that’s all(denotes the end of the Patanjali Yoga Sutra) Kaivalya is the involution of the gunas because of the fulfillment of their objectives or it is the restoration of the purusha to its inherent form which is called pure consciousness. #Online Best yoga certification courses in Bangalore
Patanjali Yoga Sutra – Kaivalya Pada Dominance of action or karma
Patanjali Yoga Sutra – Kaivalya Pada Dominance of action or karma 4.7. Karmasuklakrsnam yoginastrividhamitaresam| Karma-action Asukla-not white Akrsnam-not black Yoginah-of the yogis Trividham-threefold Itaresam-of others The deed of yogis are neither white nor black, of others they are threefold. Patanjali Yoga Sutra – Kaivalya Pada Exhibition of potential desires 4.8. Tatastadvipakanugunanamevabhivyaktirvasanam| Tatah-therefrom Tadvipaka-the ripening of those Anugunanam-accordingly Eva-only Abhivyaktih-manifestation Vasanam-of potential desires Therefrom the exhibition of potential desires according to their activities, ripening only. Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions 4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat| Jati-class of birth Desa-place Kala-time Vyavahitanam-separated Api-even Anantaryam-sequence Smrtisamskarayoh-of memory and impressions Ekarupatvat-because of sameness in form Because memory and impression are the same in form there is a sequence although they may be classified by class of birth, place and time. Patanjali Yoga Sutra – Kaivalya Pada Source of potential impressions 4.10. Tasamanaditvam chasiso nityatvat| Tasam-there is Anaditvam-begnninglessness Cha-and Asisah-of the will to live Nityatvat-by permanence There is no beginning to them and the desire to live is eternal. Patanjali Yoga Sutra – Kaivalya Pada Vanishing of impressions 4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah| Hetu-cause Phala-effect Asraya-support Alambanaih-object Sangrhitatvat-because of being bound together Esam-of these Abhave-on the disappearance Tadabhavah-their disappearance Since cause and effect, support and object are act together, by their disappearance that also disappears. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Past & future exist 4.12. Atitanagatam svarupo’styadhvabhedadharmanam| Atita-past Anagatam-future Svarupatah-in its essential form Asti-exists Adhvabhedat dharmanam- of inherent properties Past and future exist in their own form by difference of paths. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Reason for existence 4.13. Te vyaktasuksma gunatmanah| Te-they Vyakta-manifest Suksma-subtle Gunatmanah-of the nature of gunas Whether manifest or unmanifest they are of the nature of gunas.
Patanjali Yoga Sutra – Kaivalya Pada: Pure Mind
Patanjali Yoga Sutra – Kaivalya Pada: Pure Mind 4.4. Nirmanachittanyasmitamatrat| Nirmana-creation Chittani-minds Asmita-egoism Matrat-alone Created minds are free from egoism alone. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Pure mind controls 4.5. Pravrttibhede prayojakam chittamekamanekesam| Pravrtti-activity Bhede-in connection wit the difference Prayojakam-moving Chittam-mind Ekam-one Anekesam-of many The pure mind directs the many in related with the difference of activities. Patanjali Yoga Sutra – Kaivalya Pada Meditative mind is freee from past impressions 4.6. Tatra dhyanajamanasayam| Tatra-there, of them Dhyanajam-born of meditation Anasayam-without the store of past impressions The mind which is born out of meditation, is free of past impression or vasanas. #Online Best yoga certification courses in Bangalore
Patanjali Yoga Sutra – Kaivalya Pada: Sources of psychic powers
Patanjali Yoga Sutra – Kaivalya Pada: Sources of psychic powers Arise of psychic powers 4.1. Janmausadhimantratapahsamadhijah siddhayah| Janma-birth Ausadhi-herbs Mantra-mantra Tapah-austerity Samadhi-trance Jah-born of Siddhayah-siddhis The siddhis(psychic powers) arises of birth, herbs, mantras, tapas or austerities, or samadhi. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Inherent Transformation 4.2. Jatyantaraparinamah prakrtyapurat| Jatyantara-another birth Parinamah-transformation Prakrti-nature Apurat-by making up, overflowing By the overflow of inherent potentiality creates the transformation from one substance into other substances. Patanjali Yoga Sutra – Kaivalya Pada Instrumental cause 4.3. Nimittamaprayojakam prakrtinam varanabhedastu tatah ksetrikavat| Nimittam-instrument Aprayojakam-indirect Prakrtinam-of various natural tendencies Varana-obstacles Bhedhah-removal Tu-but Tatah-therefore Ksetrikavat-like the farmer The instrumental cause does not stir up the various natures but simply clears the obstacles in the path of transformation. #Online Best yoga certification courses in Bangalore
HATHA YOGA PRADIPIKA
HATHA YOGA PRADIPIKA The Hatha Yoga Pradipika is compiled by Yogi Swatmarama, an outstanding personality among many authorities of Hatha Yoga i.e. Goraknanath, Gheranda and Srinivasa Bhatta. Hatha Yoga is a very important science for man all the time. The beauty of the Hatha Yoga Pradipika is that it solves a very great problem of every aspirant. The term Hatha is a combination of two big mantras, i.e. Ha & tha where Ha represents mind, the mental energy. That represents prana the vitral force. So Hatha yoga means the union between the pranic and mental force. This is the awakening of higher consciousness. In another description, Ha means moon; that means sun “This is a symbolic of the twin energy forces which exists in everything. It represents the forces of mind, prana or vitality. Which constitute body and mind? The term Pradipika actually means self illuminating or that which illumines. So it is a text which illumines a multitude of physical, mental and spiritual problems for the aspirants. #Online Best yoga certification courses in Bangalore As in yoga, life and consciousness are known as Purusha and Prakriti and in Tantra they are called Shakti and Shiva, similarly in Hatha yoga they are known as Ida and Pingala. In Hatha yoga it begin by saying the one should first purify the whole body the stomach, intestines, nervous system and other systems. By discipline the body the subtle elements, the energy channels (Nadis) within the body should be purified. The behaviour of the vital life force (Prana), the entire nervous system and the various secretions in the body should be properly maintained and harmonized. In this way it will be possible to develop deep meditation. These practices will induce pratyahara and leading dharana dhyana and Samadhi. The main objective of Hatha Yoga is to create an absolute balance of the interacting activities and processes of the physical body, mind and energy. When this balance is created the impulses created give a call of awakening to the control force (Sushmana nadi) which is responsible for the evolution of human consciousness. Therefore it considers Hatha Yoga as the preliminary practice of Tantra, Raja Yoga, Kundalini Yoga and Kriya Yoga. #Online Best yoga certification courses in Bangalore Totally there are four chapters, Chapter I – Asana 67 verses Chapter II – Pranayama and Kriya 78 verses Chapter III – Mudras and Bandhas 130 verses Chapter IV – Samadhi, Nadanusandhana 114 verses Four major sources of Hatha yoga from 6th to 13th century AD. Hatha Yoga Pradipika – Svatmarama Goraksa Samitha – Gorakhnanth Gheranda Samitha – Gheranda Hatha Ratnavali – Srinivasa Bhatta OBJECTIVE Purification and harmonization of Body, Prana and Mind – leading to Raja yoga. Histroical Aspects Vedas & Upanisads – 5000 BC Bhagavad Gita – 300 BC Bhagavata – 1500 BC Patanjali Yoga Sutra – 1800 BC Buddha – 600 BC Jain – 300 BC Hatha Yoga Texts – From 1000 AD to 1600 AD #Online Best yoga certification courses in Bangalore Hatha Yoga Pradipika Four Chapters – Sadanga Yoga 1. On Asanas Yamas & Niyamas – Do’s & Dont’s Asanas – Postures 2. On Pranayamas Shatkriyas – Cleansing techniques Pranayamas – Mastery over prana 3. On Mudras Bandhas – Locks Mudras – Symbols 4. On Samadhi Samadhi – Absorb Yama & Niyama 1. Ahimsa – Non violence 2. Satya – Truthfulness 3. Asteya – Non stealing 4. Brahmacarya – Continence 5. Ksama – Forgiving 6. Dhrti – Endurance 7. Daya – Compassion 8. Arjavam – Straight forwardness 9. Mitahara – Sparing diet 10. Saucam – Cleanliness Niyamas 1. Tapas – Penance 2. Santosa – Contentment 3. Sravana – Hearing the scriptures 4. Isvara pujanam – Worship of god 5. Astikyam – Belief in god 6. Danam – Charity 7. Hrih – Modesty 8. Matih – Analysis 9. Hutam – Yajna 10. Tapah – Offering #Online Best yoga certification courses in Bangalore CHAPTER – 1 Asanas (67 Verses) Yogi Swatamaram instructs that Hatha Yoga is only for the highest stage of Yoga Astha Sidhis • Anima – The ability to become very small • Laghima – The ability to become very light or weightless • Mahima – The ability to become as large as possible • Garima – The ability to become heavy • Prapti – The ability to reach any place • Prakamya – The ability to stay under the water and to maintain the body Youthful. • Vasitva – The ability to control over all objects, Organic and inorganic • Isitva – The ability to create and destroy at will Preparations Place of Practice, the Hatha Yogi should live alone in a heritage and practice in a place where there is no hazard from rocks, fire, or water and which is in a well administered and virtuous kingdom (nation or town) where good alms can be easily attained. There are six causes of failure in Sadhna • Over eating • Exertion • Talkativeness • Adhering to rules • Company of Common people • Unsteadiness. Asana is the first part of Hatha Yoga Asana or specific body position opens the energy channels and psychic centers. The Hatha Yogis found that by developing control of the body through asana the mind is controlled. According to Hatha Ratnavali Lord Shiva taught 84 asanas, taking the examples of 84, 00,000 creations. Ghraksha Satarka says – every one of the 8, 40,000 asanas had been told by Lord Shiva. Out of them 84 postures have been selected of all the Haöha Yoga exist, Gheranda Samhita described 32 asanas and Hatha Ratnavali names the 84 asanas. Asanas presented in Hatha Yoga Pradipika. • Swasthikasana
GHERANDA SAMHITA
GHERANDA SAMHITA Gheranda Samhita is a systematically written text on yoga. It is in the form of a dialogue between Gheranda the preceptor and Chandkapali the (pupil). The yoga that has been discussed in Gheranda Samhita is called Ghathasta Yoga. “Gatha” refers to the body. Ghathasta Yoga means Yoga based approach through the body and the training of the body is the first step to the training of the mind. Obviously Ghathastha Yoga or Ghathastha Yoga deals with the Hatha Yoga practices. It describes more than 100 Yogic practices of varied nature. These practices can be classified as follows: Kriyas – 06 Dhautis – 13 Bastis – 12 Neti – 01 Lauli – 01 Kapalabhati – 03 Trataka – 01 Asanas – 32 Mudras – 25 Pratyahara – 5 Pranayama – 10 Dhyana – 3 Samadhi – 6 Total 102 In these Yogic practices there is gradual evolution of the process from Physical to Spiritual through Psychological process. Gheranda Samhita explains all the above practices in seven lessons. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – 1 On the training of the physical body The training of the body is the first step to the training of the mind. A healthy mind can exist only in a healthy body. Hence the Hatha Yoga or training of the body is the first step to the training of the mind or Raja yoga. Lesson first start with the question of Chandkapali who wishes to know the physical discipline (Yoga) leads to the knowledge of truth (Tattava Jnana). Gheranda explains there is no fetters like those of illusion (maya) no strength like that which comes from discipline (Yoga). There is no friend higher than knowledge (Jnana) and no greater enemy than egoism (Ahankara). As by learning the alphabets, through practice one can master all the sciences, so by thoroughly practicing, first the (physical) training, one requires the knowledge of the truth. By practice of yoga one can overcome maya. There are seven exercises which pertain to the training of the body. They are particularly strengthening, steadying, calming and those leading of lightness, perception and isolation. The satkarmas are the six processes which include Dhauti, Basti, Neti, Laukiki, Trataka and kapalabhati. The technique and importance of these are also given in details. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore The sapta Sadhanas are, Kriyas – For cleansing Asanas – Gives Dridhata or strength Mudras – Gives Sithirata or Steadiness Pratyahara – Gives Dhairya or calmness Pranayama – Gives lightness or Laghima Dhyana – Gives perception or pratyakshatwa Samadhi – Gives Isolation, nirtipta which is the freedom #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER -II Asanas and Postures There are 84, 00,000 asanas described by Lord Shiva, The postures are as many in the numbers of species of living creature in the universe. Among them 84 are the best and among these 32 have been found useful for mankind in this world. Sidhasana – Perfect Padmasana – Lotus Bhadrasana – Gentle Muktasana – Free Vajrasana – Adamant Swastikasana – Prosperous Simhasana – Lion Gomukhasanan – Cow – mouth Veerasana – Heroic Dhanurasana – Bow Maritasana – Crops Guptasana – Hidden Matsyasana – Fish Matsyendasana – Sage Gorakasana – Sage Paschimotanasana – Fish Utkatasana – Hazardous Sankatasana – Dangerous Mayurasana – Peacock Kukkutasana – Cock Kurmasana – Tortoise Uttanamandukasana – Frog Uttanakurmasana – Tortoise Vrikshasana – Tree Mandukasana – Frog Garndasana – Eagle Vrishasana – Bull slabhasana – Locust Makarasana – Crocodile Ustrasana – Camel Bhujangasana – Snake #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore The very first asana – namely siddhasana is described as mokkna-kavatabhedanka (which opens the doors of realization, Padmasana, Bhadrasana, Simhasana, Matsyasana, all these destroy all sorts of disease). Muktasana gives siddhis (perfection) Vajrasana gives psychic powers to the yogi. Mritasana destroy fatigue and quiten the agitations of the mind. Gorakasana gives success to the yogis; Mayurasana destroys the effect of whole some food. It produces heat in the stomach; it destroys the effect of deadly poisons. If easily cures diseases like fever etc. Makarasana increases the body heat, Bhujangasana (serpent) always increases the bodily heat, destroys all diseases and by the practice of this posture the Kundalini force is awakened. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – III Mudras There are 25 Mudras the practice of which gives senses to the yogis, they are. Mahamudra Nabho Uddiyana Jalandhara Mulabandha Maha Bandha Maha Bheda Khecari Viparita Karani Vajroli Sakticalana Tadagi Mandauki Sambhavi 20 Panca Dharma (Five Dharma) Asvini Pasini Kaki Matangini Bhujanginini These Mudras which gives happiness and emancipation. These Mudras destroys all diseases. There is nothing in the world like the Mudras for giving quick success. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – IV Prathyahara By prathyahara all the passions like lust are destroyed. Let one bring the chitta (thinking principle) under his control by withdrawing it wherever it wanders away driven by the various objects of right, praise or censer good or bad, speech, sweet or bad, smell or taste or what ever the mind may be distracted or attracted. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER -V Pranayama Four things are necessary for practicing Pranayama in Good place. Suitable time Moderate food. Purification of the Nadis The purification of the Nadis is of two sorts. Samanu and Nirmanu. The Samanu is done by a mental process with Bijamantra. The Nirmanu is performed by physical cleanings. After purification of the Nadis one has to sit firmly in a posture and be in regular Pranayama. #50/100/200/300/500 hr Yoga teacher
Patanjali Yoga Sutra – Vibhuti Pada: Samyama and psychic powers
Patanjali Yoga Sutra – Vibhuti Pada: Samyama and psychic powers By samyama knowledge of past & future 3.16. Parinamatrayasamymadatitanagatajnanam| Parinama-transformation Traya-three Samymat-by samyama Atita-past Anagatah-future Jnanam-knowledge By practicing samyama on the three transformations, knowledge of past and future thing arise. By samyama knowledge of all speech 3.17. Sabdarthapratyayanamitaretaradhyasat saìkarastat pravibhagasamyamat sarvabhutarutajnanam| Sabda-word Artha-object Pratyayanam-mental content Itaretaradhyasat-because of mental superimposition Sankara-confusion Tat-that Pravibhaga-separate Samyamat-by samyama Sarvabhuta-all living beings Ruta-speech Jnanam-knowledge#Yoga course Bangalore The word, object and mental content are in a confused condition because of mutual superimposition. By practicing smyama on them separately, knowledge of the speech of all beings arises. By samyama knowledge of previous birth 3.18. Samskarasaksatkaranat purvajatijnanam| Samskara-impression Saksatkaranat-by direct impression Purva-previous Jati-birth Jnanam-knowledge By direct perception of the impressions, knowledge of previous births comes. By samyama knowledge of other’s mind 3.19. Pratyayasya parachittajnanam| Pratyayasya-of the content of the mind Para-another Chitta-mind Jnanam-knowledge By practicing samyama on the pratyayas, knowledge of others mind known. But not mental image 3.20. Na tat salambanam tasyavisayibhutatvat| Na-not Tat-that Salambanam-with support Tasya-its Avisayibhutatvat-because of not being the subject of samyama But the knowledge of other mental factors is not gained with support of the mental image because that is not the object of samyama. #Yoga course Bangalore By samyama power of invisibility 3.21. Kayarupasamyamat tatgrahyasaktistambhe chaksuhprakasasamprayoge’ntardhanam| Kaya-body Rupa-form Samyamat-by doing samyama Tat-that Grahya-receptive Sakti-power Stambhe-on suspension ChakSuh-the eye Prakasa-light Samprayoga-absence of contact Antardhanam-being invisible By applying samyama on the form of the body and suspended receptivity of the form, there being no contact between the eye and the light, the yogi can become invisible. By samyama power of disappearance 3.22. Etena sabdadyantardhanamuktam| Etena-by this Sabdadi-sound and others Antardhanam-disaapearance Uktam-said By what has been said the vanish of sound and other tanmatras can be understood. #Yoga course Bangalore By samyama knowledge of time of death 3.23.Sopakramamnirupakramam cha karma tatsamyamadaparantajnanamapyaristebhyo va| Sopakramam-the karma which activity Nirupakramam-the karma that is dormant Cha-and Karma-action Tat-that Samyamad-by performing samyama Aparanta-death Jnanam-knowledge Aristebhyah-by omens Va-or Karma is of two types, active and dormant. By applying samyama on them knowledge of death is gained, also by omens. By samyama power of friendliness 3.24. Maitryadisu balani| Maitri-frienliness Adisu-etc Balani-powers By applying samyama on friendliness, etc. there come those particular powers friendliness. By samyama attainment of strength 3.25. Balesu hastibaladini| Balesu-by samyama on the powers Hasti-elephant Bala-stength Adini-etc By applying samyama on the stenght of an elephant, etc. the corresponding strength is gained. By samyama gain hidden knowledge 3.26. Pravrttyalokanyasat suksmavyavahitaviprakrstarsva jnanam| Pravrtti-super physical faculty Aloka-like Nyasat-by projecting Suksma-fine Vyavahita-hidden Viprakrsta-distant Jnanam-knowledge The knowledge of subtle, obscure or distant objects is profited by dilating the light of the superphysical faculty. By samyama knowledge of the solar system 3.27. Bhuvanajnanam suryasamyamat| Bhuvana-solar system Jnanam-knowledge Surye-on the sun Samyamat-by performinf samyama Knowledge of the solar system is gained by applying samyama on the sun. By samyama knowledge of the stars 3.28. Candre taravyuhajnanam| Candre-moon Tara-stars Vyuha-arrangements Jnanam-knowledge By applying samyama on the moon, knowledge about the position of the stars is benefited. #Yoga course Bangalore By samyama knowledge of star movements 3.29. Dhruve tadgatijnanam| Dhruve-by performing samyama on the pole star Tat-that Gati-movement Jnanam-knowledge By applying samyama on the pole star, knowledge of the movement of the stars can be acquired. #Yoga course Bangalore By samyama knowledge of the body 3.30. Nabhichakre kayavyuhajnanam| Nabhi-navel Chakre-centre Kaya-body Vyuha-arrangement Jnanam-knowledge By applying samyama on the navel centre, knowledge of the arrangements in the body is obtained. By samyama mastery over hunger & thirst 3.31. Kanthakupe ksutpipasa nivrttih| Kanthakupe-by performing samyama on the throat Ksut-hunger Pipasa-thirst Nivrttih-retirement By applying samyama on the throat pit, hunger and thirst would not happen. 3.32. Kurmanadyam sthairyam| Kurmanadyam-by performing samyama on the kurma nadi Sthairyam-staediness Stableness is gained by applying samyama on the kurma nadi. #Yoga course Bangalore By samyama gain spiritual vision 3.33. Murdhajyotisi siddhadarsanam| Murdha-crown of the head Jyotisi-on the light Siddha-adept Darsanam-spiritual vision By applying smayama on the light of the crown of the head at sahasrara cakra, a spiritual vision of the masters of yoga is obtained. By samyama acquire intuitive knowledge 3.34. Pratibhadva sarvam| Pratibhat-from pratibha Va-or Sarvam-everything Or everything by virtue os pratibha or intuition. By samyama gain awareness of consciouness 3.35. Hradaye chittasamvit| Hradaye-by performing smayama on the heart Chittasamvit-awareness of the consciousness By applying samyama on the heart, awareness of consciouness dawns. #Yoga course Bangalore By samyama knowledge of universal consciousness 3.36. Sattva purusayoratyantasanké rnayoh pratyayaviseso bhogah pararthatvat svarthasamyamat purusa jnanam| Sattva-chitta Purusayoh-of the purusha Atyanta-extremely Asankirnayoh-distinct Pratyaya-awareness Avisesah-not distinct Bhogah-experience Pararthatvat-from objective consciousness Sva-ones own Artha-subjective awareness Samyamat-by samyama Purusajnanam-knowledge of purusha Chitta and purusha are extremly different. On account of non-difference of the awareness of both there is objective or subjective experience. By applying samyama on subjective awareness apart from objectives awareness, the knowledge of purusha is acquired. By samyama gain power of intuitive perception 3.37. Tatah pratibhasravanavedanadarsasvadavartta jayante, Tatah-therefrom Pratibha-the faculty of superior consciousness Sravana-the faculty of hearing Vedana-touch consciousness Darsa-visulization Asvada-faculty of taste Vartta-the olfactory faculty Jayante-are produced By applying samyama gain power of intuitive perception, therefrom are produced transcendental audition, sensation, perception, taste and olfactory knowledge. #Yoga course Bangalore
Patanjali Yoga Sutra – Vibhuti Pada – Psychic powers are obstacles in path of Yoga
Patanjali Yoga Sutra – Vibhuti Pada – Psychic powers are obstacles in path of Yoga 3.38. Te samadhvupasarga vyutthane siddhayah| Te-they Samadhau-in samadhi Upasarga-obstacles Vyuttane-in the state of the consciousness of the world Siddhayah-psychics powers These psychic powers or siddhis are hindrances in path of samadhi, but in the state of consciousness of the world they are psychic powers. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of entering another’s body 3.39. Bandhakaranasaithilyat pracarasamvedanachcha chittasya parasarirapravesah| Bandha-bondage Karana-cause Saithilyat-by loosening Prachara-passage Samvedanat-by knowledge Cha-and Chittasya-of the subtle body Para-of others Sarira-body Avesah-entry By releasing of the cause of bondage and by knowledge of the passage, the subtle body enters another person’s body. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of levitation 3.40. Udanajayajjalapankakantakadisvasanga utkrantischa| Udana-one of the five pranas Jayat-by mastery Jala-water Panka-mud Kantakadisu-with thorns etc. Asanga-no contact Utkrantih-levitation Cha-and By samyama on udana upa prana there is non-contact with water, mud, thorns etc. and the body gets levitated. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain Aura 3.41. Samanajayajjvalanam| Samana-the samana vayu Jayat-by mastery Jvalanam-blaze By applying samyama on the samana vayu, the body blazes. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of divine hearing 3.42. Srotrakasayoh sambandhasaàyamaddivyam srotram| Srotra-ear Akasayoh-space Sambandha-relation Samyamat-by samyama Divyam-divine Srotram-organ of hearing By applying samyama on the relation of the ear and space, gained divine hearing. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain faculty of moving through space 3.43. Kayakasayoh sambandhasamyamallaghutulasamapatteschakasagamanam| Kaya-body Akasayoh-of space Sambandha-relation Samyamat-by samyama Laghu-light Tula-cotton, wool Samapatteh-by fusion of mind Cha-and Akasa-space Gamanam-going through By applying samyama on the relation of body and space and by joining the mind wit the lightness of cotton, there is going through space. #200 hour Yoga teacher training certificate course in Bangalore Gain universal state of mind 3.44. Bahirakalpita vrttirmahavideha tatah prakasavaranaksayah| Bahih-external Akalpita-unimaginable Vrttih-state of mind Mahavideha-existence wihout body Tatah-therefrom Prakasa-light Avarana-covering Ksayah-distraction In the state of, existence without body, the vrittis are inconceivable and outside the scope of the body, whereby the covering of light is destroyed. #200 hour Yoga teacher training certificate course in Bangalore By samyama mastery over twenty five tattvas or bhutas 3.45.Sthulasvarupasuksmanvayarthavattvasamyamadbhutajayah| Sthula-gross Svarupa-real form Suksma-subtle Anvaya-interpenetrating Arthavattva-serving the purpose Samyamad-by samyama Bhutajayah-mastery over elements By performing samayama on the gross, basic, subtle and interpenetrating states and the purpose of the bhutas, mastery over them is gained. #200 hour Yoga teacher training certificate course in Bangalore By samyama attainment of eight psychic powers(asta siddhis) 3.46.Tato’nimadipradurbhavah kayasampattaddharmanabhighatascha| Tatah-therefrom Animadi-anima etc. Pradurbhavah-appearance Kayasampat-bodily well Tat-that Dharma-function Anabhighatah-non-obstructions Cha-and From that the appearance of anima, perfection of the body and non-obstruction from the functions of the body gained. #200 hour Yoga teacher training certificate course in Bangalore Perfection of the physical body 3.47. Rupalavanyabalavajrasamhananatvani kayasampat| Rupa-form, beauty Lavanya-grace Bala-stength Vajrasamhananatvani- hardness Kaya-physical Sampat-wealth The perfection of the physical body includes beauty, grace, energy, and hardness. #200 hour Yoga teacher training certificate course in Bangalore By samyama mastery of sense organs 3.48. Grahanasvarupasmitanvayasamyamadindriyajayah| Grahana-power of cognition Svarupa-real nature Asmita-egoism Anvayarthavatva samyamat-by samyama Indriyajayah-mastery over the sense organs Mastery over the sense organs is obtained by applying samyama on the power of cognition, real nature, egoism, all-pervasiveness and purposefulness. #200 hour Yoga teacher training certificate course in Bangalore Mastery over prakriti 3.49. Tato manojavitvam vikaranabhavah pradhanajayascha| Tatah-therefrom Manojavitvam-speed of mind Vikaranabhavah-freedom from sense organs Pradhanajayah-conquest of prakriti Cha-and Therefrom follows speed like that of mind, independent from any medium of instrumentality and mastery of the limitations of prakriti. #200 hour Yoga teacher training certificate course in Bangalore By samyama power of omnipotence & omniscience 3.50. Sattvapurushanyatakhyatimatrasya sarvabhavadhisthatrtvam sarvajnatrtvam cha| Sattva-chitta Purusha-self Anyata-difference Khyati-awareness Matrasya-only Sarva-all Bhava-states of existence Adhisthatrtvam-supermacy Sarvajnatrtvam-omniscience Cha-and Just by knowledge of the awareness of the difference between chitta and purusha follows supermacy over all states and forms of existence and omniscience. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain detachment and knowledge 3.51. Tadvairagyadapi dosabijaksaye kaivalyam| Tat-that Vairagyat-by vairagya Api-even Dosa-defect Bija-seed Ksaye-due to destruction Kaivalyam-isolation By detachment, even regarding the powers, the seed of defect is eliminated and kaivalya is reached. #200 hour Yoga teacher training certificate course in Bangalore Causes of downfall in spiritual path 3.52. Sthanyupanimantrane sangasmayakaranam punanistaprasangat| Sthani-gods Upanimantrane-on being respectfully Sanga-attachment Smaya-pride Akaranam-by not Punah-once again Anista-undesirable Prasangat-by revival On being invited by the gods there should be no attachment and pride, because of the possibility of revival of the undesirable. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain awareness of ultimate reality 3.53. Ksana tatkramayo samyamdvivekajam jnanam| Ksana-moment Tatkramayoh-its order of succession Samyamat-by samyama Vivekjam-born of realization Jnanam-knowledge By applying samyama on moment and its order of succession is born the knowledge of realization of the ultimate reality. By samyama knowledge of distinctions 3.54. Jatialaksana desairanyatanavachchhedat tulyayostatah pratipattih| Jati-birth Laksana-charaterictic Desayoh-by place Anyata-difference Anavachchhedat-on account of no definiton Tulyayoh-of the two similar objects Tatah-therefrom Pratipattih-knowledge By samyama transcendental knowledge 3.55. Tarakam sarvavisayam sarvatha visayamakramam cheti vivekajam jnanam| Tarakam-transcendental Sarvavisayam-all subjects sarvatha visayam-object of every place akramam-beyond the order of successon cha-and iti-that is all vivekajam jnanam- knowledge born of viveka Transcendental knowledge includes the knowledge of all objects beyond all orders of succession and is born of discrimination. Attainment of kaivalya 3.56. Sattvapurusayoh suddhisamye kaivalyamiti| Sattva-chitta Purusayoh-of the purusha Suddhi-purification Samye-on becoming equal Kaivalyam-isolation Iti-end Kaivalya is attained by equalizing and cleansing the illumination of purusha and chitta.
Patanjali Yoga Sutra-Vibhuti Pada – What is Concentration?
Patanjali Yoga Sutra – Vibhuti Pada – What is Concentration? 3.1 Desabandhaschittasya dharana | #Yoga teacher training certificate course fees in Bangalore Desa-place Bandha-binding Chittasya-of the mind Dharana-concentration Cocentration is bringing the mind to one place with effort. #Yoga teacher training certificate course fees in Bangalore Patanjali Yoga Sutra – Vibhuti Pada What is Meditation? 3.2. Tatra pratyayaikatanata dhyanam| Tatra-there(in the desha) Pratyaya-basis or content of consciousness Ekatanata-continuity Dhyanam-meditation Uninterrupted stream of the content of consciouness is Meditation. #Yoga teacher training certificate course fees in Bangalore Patanjali Yoga Sutra – Vibhuti Pada What is Samadhi or superconsciousness? 3.3.Tadevarthamatranirbhasaà svarupasunyamiva samadhih| Tadeva-the same Artha-the object of dhayana Matra-only Nirbhasam-appearing Svarüpa-one own form Sunyam-empty Iva-as if Samadhih-trance Samadhi is called, when there is only the object appearing without the consciousness of ones own self.
Patanjali Yoga Sutra – Sadhana Pada – Eight limbs of Yoga
Patanjali Yoga Sutra – Sadhana Pada – Eight limbs of Yoga 2.29.Yamaniyamasanapranayamaprtayaharadharanadhyanasamadhayo’stavangani| Yama-self restraints Niyama-fixed rules Asana-postures Pranayama-breath control Pratayahara-sense withdrawl Dharana-concentration Dhyana-meditation Samadhai-samadhi Asta-eight Angani-parts Personal ethics, social ethics, postures, breath control practice, sense withdrawl from its sense objects, concentration, meditation and samadhi or supersonsciouness, constitute the eight limbs of yoga discipline. Five Self-Discipline 2.30. AhimsaSatyaAsteyaBrahmacharyaaparigraha Yamah| Ahimsa- Non-violence Satya- truthfullness Asteya- honesty Brahmacarya-sensual abstinence Aparigraha-non-acquistiveness Yamah-self-restraints Non-violence, truth, honesty, sensual abstinence, and non-possesiveness are the five self-disciplines. Following Self-Discipline is the great Path 2.31. Jatidesakalasamayanavacchinnah sarvabhauma mahavratam| Jati-class of birth Desa-country, or place Kala-time Samaya-circumstances Anavacchinnah-unconditioned Sarvabhauma-universal Mahavratam-the great discipline It can be practiced universally without exception due to birth, place, time and circumstances then yamas become great disciplines. Social-discipline for yoga practice 2.32. Sauchasantosatapahsvadhyayesvarapranidhanani niyamah| Saucha-clenaliness Santosa-contentment Tapah-austerity Svadhyaya-self-study Isvara pranidhanani-resignation to god Niyamah-fixed rules Cleanliness, contentment, austerity, self-study and self-surrender to God constitute social discipline. Path to remove mind disturbance 33. Vitarkabadhane pratipaksabhavanam| Vitarka-passions Badhane- on disturbances Pratipaksa-the opposite Bhavanam-pondering over#Yoga teacher training certificate course fees in Bangalore When the mind is disturbed by passions one should practise contemplating over their opposites nature. Qualities and characteristics of mind disturbances 2.34. Vitarka himsadayah krtakaritanumodita lobhakrodhamohapurvaka mrdumadhyadimatraduhkhajnananantaphala iti pratipaksabhavanam| Vitarka-evil passions Himsadayah-violence and others Krta-done by ones self Karita-done through others Anumodita-approved Lobha-gree#Yoga teacher training certificate course fees in Bangalore Krodha-anger Moha-confusion Purvaka-preceded by mrdu-mild madhya-moderate adhimatra-intense duhkha-pain ajnana-ignorance ananta-infinite phalah-reults iti-like that pratipaksa-opposite bhavanam-thinking Thinking of evil thoughts such as violence, whether done through oneself, through others, or approved, is caused by greed, anger and confusion. They can be mild, medium, or intense. Pratipaksha bhavana is thinking that these evil thoughts cause infinite pain and ignorance. Benefits of following Non-Violenc #Yoga teacher training certificate course fees in Bangalore 2.35. Ahimsapratisthayam tatsamnidhau vairatyagah| Ahiàsa-non-violence Pratisthayam-on being firmly established Tatsamnidhau-in its vicinity Vaira-hostility Tyagah-abandonment Those who following strongly ahimsa path, there is abandonment of hostility and enmity in his vicinity. Benefits of following Truthfulness 2.36. Satyapratisthayam kriyaphalasrayatvam| Satya-truthfulness Pratisthayam-on being firmly established Kriya-action Phala-result or fruit Asrayatvam-basis Those who following truthfullness, the actions result in fruits, entirely depending on them. Benefits of being honesty 2.37. Asteyapratisthayam sarvaratnopasthanam| Asteya-honesty Pratisthayam-on being firmly established Sarva-all Ratna-gems Upasthanam-self-presentation By being firmly established in honesty path, so all gems present with themselves. Benefits of being celibacy 2.38. Brahmacharyapratisthayam viryalabhah| Brahmacharya-sexual abstinence Pratisthayam-on being firmly established Virya-indomitable courage Labhah-gain By following celibacy, veerya is gained. #Yoga teacher training certificate course fees in Bangalore Benefits of following Non-possessiveness 2.39. Aparigrahasthairye janmakathantssambodah| Aparigraha-non-possessiveness Sthairye-on becoming steady Janma-birth Kathanta-how and from where Sambodah-knowledge On becoming stable in non-possessiveness, there arises the knowledge of how and from where birth arise. Benefits of being cleanliness #Yoga teacher training certificate course fees in Bangalore 2.40. Saucat svanga jugupsa parairasaàsargah| Saucat-from clealiness Svanga-one own body Jugupsa-indifference Paraih-with others Asamsargah-non-attachment By being cleanliness there comes indifference towards one’s own body and non-attachment to others. Control of mind through cleanliness 2.41. Satvasuddhi saumanasyaikagryendriyajayatmadarsanayogyatvani cha| Satvasuddhi-purity of internal being Sauomanasya-cheer fullness Ekagrya-one-pointedness Indriyajaya-control of senses Atmadarsana-vision of the self Yogyatvani-ftness Cha-and By the practice of mental purity one gains qualification for cheerfulness, one-pointedness, sense control and vision of the self. Benefits of being contentment #Yoga teacher training certificate course fees in Bangalore 2.42. Santosadanuttamasukhalabhah| Santosad-from contentment Anuttamah-unexcelled Sukha-pleasure Labhah-gain Infinite happiness comes from the practice of contentment. Benefits of austerities 2.43. Kayendriya siddhirasuddhiksayattapasah| Kaya-the body Indriya-sense organ Siddhi-perfection Asuddhi-impurity Ksayat-destruction Tapasah-by austerities By following austerities, impurities are eradicated and there appears perfection in the body and sense organs. Benefits of self-study #Yoga teacher training certificate course fees in Bangalore 2.44. Svadhyayadistadevatasamprayogah| Svadhyayat-by self-awareness, self-obsrvation Istadevata-the deity of choice Samprayogah-communion By self-study, union with the desired deity is brought about. Benefits of self-surrendering to God 2.45. Samadhisiddhirisvarapranidhanat| Samadhi- superconsiousness Siddhi-perfection Isvara-god Pranidhanat-self-surrender Succcess in superconsiousness comes by complete resignation to God. How should be Asana? #Yoga teacher training certificate course fees in Bangalore 2.46. Sthirasukhamasanam| Sthira-steady Sukham-comfortable Asanam-posture Steady and comfortable should be the posture. How to mastery Asana 2.47. Prayatnasaithilyananatasamapattibhyam| Prayatna-effort Saithilya-looseness Ananta-the serpent called ananta Samapattibhyam-by meditation By effortless effort and by meditation on the serpent ananta, asana is mastered. Benefits of by mastery over Asana 2.48. Tato dvandvanabhighatah| Tatah-from that Dvandva-pair of opposites Anabhighatah-no impact Thereby the pairs of opposites stop to have any impact. What is pranayama? 2.49. Tasmin sati svasaprasvasayorgativichchhedah pranayamah| Tasmin-on that Sati-having been Svasaprasvasayah-inhalation, exhalation Gati-movement#Yoga teacher training certificate course fees in Bangalore Vichchhedah-break, cessation Pranayamah-pranayama After the asana practice done, pranayama is the stopping of the movement of incoming and outcomng breath. Types of Pranayama 2.50. Bahyabhyantarastambhavrttih desakalasankhyabhih paridrsto dirghasuksmah , Bahyah-outer Abhyantara-internal Stambhavrttih-supperessed stage Desa-place Kala-time Sankhyabhih-number Paridrstah-measured Dirgha-prolonged Suksmah-subtle Pranayama is external, internal #Yoga teacher training certificate course fees in Bangalore or suspended, regulated by place, time and number and becomes prolonged and subtle. Fourth type of pranayama 2.51. Bahyabhyantaravisayaksepi chaturthah| Bahya-external Abhyantara-internal Viñaya-object Aksepi-transcending Chaturtha-fourth The fourth pranayama is that which transcends the internal and external object, called it breathless state. By practicing pranayama luminosity achieved 2.52. Tatah ksiyate prakasavaranam| Tatah-thereby Ksiyate-disappears#Yoga teacher training certificate course fees in Bangalore Prakasa-light Avaranam-covering Thereby the covering of light vanish. Pranayama for good concentration 2.53. Dharanasu cha yogyata manasah| Dharanasu-in concentartion Cha-and Yogyata-fitness Manasah-of the mind And mind becomes well qualified for concentration. Withdrawing of the mind 2.54. Svavisayasamprayoge chittasvarupanukara indriyanam pratyaharah| Sva-ones own Visaya-object Asamprayoge-not coming into contact Chitta-mind Svarupa-own form Anukara-imitating Iva-as if Indriyanam-of the senses Pratyaharah-withdrawal Pratyahara means, the imitation by #Yoga teacher training certificate course fees in Bangalore the senses of the mind by withdrawing them from their respective sense objects. Mastery over the senses by pratyahara 2.55. Tatah paramavasyatendriyanam| Tatah-thereby Parama-highest Vasyate-mastery Indriyanam-of the senses This is the highest state of mastery over the sense organs by pratyahara practice. #Yoga teacher training certificate course fees in Bangalore
Patanjali Yoga Sutra – Sadhana Pada- Reasons for experiencing pain & how to remove it?
Patanjali Yoga Sutra – Sadhana Pada- Reasons for experiencing pain & how to remove it? 2.3. Avidyasmitaragadvesabhinivesah klesah| Avidya-ignorance Asmita-i-feeling Raga-liking Dvesa-repulsion Abhinivesah-fear of death Klesah-afflictions Ignorance, I-feeling, liking, disliking and fear of death, this all are the reasons for experiencing pains in our walk of life . #Best yoga teacher training certification courses in Bangalore Ignorance is the foundation cause for all pain 2.4. Avidyaksetramuttaresam prasuptatanuvichchhinnodaranam| Avidya-avidya Ksetram-field Uttaresam-of the following Prasupta-dormant Tanu-thin Vichchhinna-scattered Udaranam-fully operated, expanded Avidya or ignorance can be resided in the states of dormant, thin, scattered or expanded. #Best yoga teacher training certification courses in Bangalore Meaning for Ignorance? 2.5. Anityasuchiduhkhanatmasu nityasuchisukhatmakhyatiravidya| Anitya-not eternal Asuchi-impure Duhkha-pain Anatmasu-non-atman Nitya-eternal Suchi-pure Sukha-happiness Atma-self Khyati-knowledge Avidya-ignorance Meaning of Avidya or Ignorance is mis-understanding of non-eternal, impure, evil things considering as eternal, pure, good and atman. Ego or ‘I’ feeling is one of the ignorance 2.6. Drgdarsanasaktyorekatmataivasmita| Drg-purusha, power of consciousness, power to see Darsana-that which is seen, cognition Saktyoh-of the two powers Ekatmata-identity Iva-as if Asmita-i-feeling Asmita or ‘I’feeling, is the identity as it were of the purusha or pure consciousness with the Buddhi or discrminated knowledge. #Best yoga teacher training certification courses in Bangalore Attachment is the one of the Ignorance 2.7. Sukhanusayi ragah| Sukha-pleasure Anusayi-accompanying Ragah-liking Raga is the liking to such activities, which gives all sensual pleasures. Hatred is one of the Ignorance 2.8. Duhkhanusayi dvesah| Duhkha-pain Anusayi-accompanying Dvesah-repulsion Disliking means, the action which gives pain to physicall and mental level. #Best yoga teacher training certification courses in Bangalore Clinging to life is one of the ignorance 2.9. Svarasavahi viduso’pi tatharudho’bhinivesah| Svarasavahi-sustained by its one force Vidush-of the learned Api-even Tatha-like that Rudhah-dominating Abhinivesah-fear of death, clining to life Abhinivesha means desire for mundane life to extend, even this quality dominates learned wise people too. #Best yoga teacher training certification courses in Bangalore Future Pain in life can be reducible 2.10. Te pratiprasavaheyah suksmah| Te-they Pratiprasavah-involution Heyah-reducible Suksmah-subtle Those future pains can be avoidable or reducible by involution or by yogic practice, when they are subtle. #Best yoga teacher training certification courses in Bangalore Through Meditation Future Pain can Be Avoidable 11. Dhyanaheyastadvrttayah| Dhyana-meditation Heyah-reducible Tadvrttayah-their modification The modifications of the kleshas are reducible through meditation. #Best yoga teacher training certification courses in Bangalore Our past accumulated action is reason for present & future pain 2.12. Klesamulah karmasayo drsthadrsthajanmavedaniyah| Klesa-affliction Mulah-root Karma-action Asayo-reservoir Drstha-seen, present Adrstha-not seen, future Janma-birth Vedaniyah-to be experienced This accumulated karmas which is the root cause of afflictions is to be experienced in the present and future births. Fruits of accumulated action 2.13. Sati mule tadvipako jatyayurbhogah| Sati mule- so long as the root is there Tat-it Vipakah-ripening Jati-birth, class Ayuh-span of life Bhogah-experience So long as the root of accumulated karma is there, it ripens and gives birth and class, span of life and experience. #Best yoga teacher training certification courses in Bangalore Fruits depend on past life action 2.14. Te hladaparitapaphalah punyapunyahetutvat| Te-they Hlada-joy Paritapa-sorrow Phalah-fruits Punya-merit Apunya-demerit Hetutvat-on account of They have happiness or sorrow as their fruits depending upon their merit or demerit of past life action. #Best yoga teacher training certification courses in Bangalore Pleasure and pain both are painful indeed 2.15. Parinamatapasamskaraduhkhairgunavrttivirodhacca duhkhamva sarvam vivekinah , Parinama-result, consequence Tapa-acute suffering Samskara-impression Duhkhaih-by these three pains Guna-three gunas Vrtti-modification of mind Virodhat-on account of, opposing Cha-and Duhkham-pain Eva-only Sarvam-all Vivekinah-those who have discrimination In the case of one who has discrimintaive knowledge (viveka), all is painful because of pains due to change, acute suffering, samskaras, and also due to gunas and vrittis in opposition. #Best yoga teacher training certification courses in Bangalore
Patanjali Yoga Sutra – Sadhana Pada- Why should follow Discipline?
Patanjali Yoga Sutra – Sadhana Pada- Why should follow Discipline? Major Discipline for Yoga Practice 2.1. Tapahsvadhyayayesvarapranidhanani kriyaayogah| Tapah- austerity Svadhyaya-self-study of scriptures Ishvarapranidhana-surrender to god Kriya yoga-practical yoga Tapas, Swadhyaya and ishwara pranidhana is caled kriya yoga. Why should one pursue discipline for Yoga Practice 2.2. Samadhibhavanarthah klesatanukaranarthasca| Samadhi-superconsciousness Bhavanarthah-for developing the state of Klesa-cause of afflictions Tanu-thin Karanartha- for making Cha-and For growing the consciousness of samadhi and for the aim of thinning out the cause of afflictions, so that kriya yoga practised. #100/200/300/500 hour Yoga teacher training India
Hatha Yoga Pradipika – Chapter Four: Samadhi
Hatha Yoga Pradipika – Chapter Four: Samadhi Synonymous words for Raja Yoga Rajayogah samadhis cha unmani cha manonmani / Amaratvam layas tattvam sunyasunyam param padam// Raja Yoga, Samadhi, Unmani, Manonmani, Amaratva, Laya, Sahaja Tattva, Shoonyashoonya, Parampadam. (Chapter -4, Verse 3). #100/200/300/500 hour Yoga teacher training India Amanaskam tathadvaitam niralambam niranjanam/ Jivanmuktischa sahaja turya chetyekavachakah// Amanaskam, advaitam, niralambha, niranjana, jivanmukti, sahaja and turiya are all synonymous words. (Chapter -4, Verse 4). #100/200/300/500 hour Yoga teacher training India Mind and Soul mixed like salt in the sea Salile saindhavam yadvatsamyam bhajati yogatah/ Tathatmamanasoraikyam samadhirabhidhiyate// As salt mixed in the sea, like that the mind and soul or atma are considered united in samadhi state. (Chapter -4, Verse 5). Ending of Prana and Mind in Samadhi state Ending of Prana and Mind in Samadhi state – Activities of prana is annihilated, then mind is reabsorbed in samadhi. Yada samkshiyate prano manasam cha praliyate/ Tada samarasatvam cha samadhir abhidhiyate// When the activities of Prana are totally annihilated, then mind is reabsorbed in samadhi state achieved. (Chapter -4, Verse 6). Individual soul merge with universal soul, all desires eliminated When Jivatma unites with Paramatma, desires are eliminated Tatsamam cha dvayoraikyam jivatmaparamatmanoh / Pranashtasarvasangkalpah samadhih so abhidhiyate// When the twofold characteristics of the individual soul and cosmic soul become one, all desires are eliminated and that state is called samadhi. (Chapter -4, Verse 7) #100/200/300/500 hour Yoga teacher training India Karmas get annihilated when prana flows in Sushumna Nadi All Karmas(actions) get annihilated when prana flows in sushumna nadi, mind remain in complete shoonya(void). Sushumnavahini prane sunye visati manase/ Tada sarvani karmani nirmulayati yogavit// When prana is moving through sushumna nadi, mind is in pure shoonya(void). Then all the karmas of the one knowing yoga are annihilated. (Chapter -4, Verse 12) #100/200/300/500 hour Yoga teacher training India Kundalini is to be blocked at Brahmarandhra Nadi The ultimate union and samadhi happens at sahasrara chakra. This location is at the crown of the head. The very upper portion of head is called brahmarandhra. The energy and consciousness must remain there, if they gone beyond, there is no return back to the physical body. Jnatva sushumnasadbhedam krtva vayum cha madhyagham / Sthitva sadaiva susthane brahmarandhre nirodhayet// Staying in the most conducive place, having found out how to penetrate sushumna and move the prana through the middle passage, it should be blocked in the brahmarandhra, the center of higher consciousness state.(Chapter -4, Verse 16). Manonmani (consciousness without mind) State Manonmani (consciousness without mind) – Manonmani is obtained when prana flows in sushumna nadi Sushumnavahini prane siddhyatyeva manonmani/ Anyatha tvitarabhyasah prayasayaiva yoghinam// When the prana travels in the sushumna nadi this state of manonmani (consciousness without mind) is obtained. Therefore, other forced practices are just laborious to the Hatha Yogi. (Chapter -4, Verse 20). #100/200/300/500 hour Yoga teacher training India Prana and mind are controlled through each other Pavano badhyate yena manastenaiva badhyate / Manascha badhyate yena pavanastena badhyate// Through controlling the prana, thought is contolled and through control of thought, prana or air is controlled. (Chapter -4, Verse 21). #100/200/300/500 hour Yoga teacher training India Chitta has two qualities: vasana and prana Hetudvayam tu chittasya vasana cha samiranah / Tayorvinashta ekasmintau dvavapi vinasyatah// Chitta has two qualities, vasana and prana. When one of the two is eliminated or deactivated the other also will become inertia. (Chapter -4, Verse 22). Stillness and interconnection between mind and prana Mano yatra viliyeta pavanastatra liyate/ Pavano liyate yatra manastatra viliyate// Where mind is stilled, then the prana is suspended there, and where prana is suspended, there the mind also gets stilled. (Chapter -4, Verse 23). Prana and Mind are united like milk and water #100/200/300/500 hour Yoga teacher training India Dughdhambuvatsammilitavubhau/ tau Tulyakriyau manasamarutau hi/ Yato maruttatra manahpravrttir // Yato manas tatra marutpravrttih// Mind and prana are united like milk and water. Two of them are equal in their activities. Where there is pranic movement or there mind also active. Where there is mind, there is prana too exist. (Chapter -4, Verse 24). Tatraikanasad aparasya nasa Ekapravrtter aparapravrttih / Adhvas tayos chendriyavarghavrttih Pradhvastayor mokshapadasya siddhih// Therefore, if one is destroyed, the other is annihilated; if one is active, the other becomes active, and while they exist, all the senses are active. If they are controlled, the state of liberation is obtained. (Chapter -4, Verse 25). Mind controlles the senses, prana controlles the mind, nada controlles the prana Indriyanam mano natho manonathastu marutah/ Marutasya layo nathah sa layo nadamasritah// Mind is the controller of the senses, prana is the controller of the mind. Dissolution is the lord of the prana and that dissolution, laya is the foundation of nada. (Chapter -4, Verse 29). Shambhavi Mudra (eyebrow center gazing) Shambhavi mudra (eyebrow center gazing) internalizes pranic flow and mind – If the Hatha Yogi remains with the chitta and prana absorbed in the internal object and gaze motionless, though seeing, he is not seeing, this is called shambhavi mudra, realm of Shiva consciousness). Antarlakshyam bahirdrshtir nimeshonmeshavarjita / Esha sa sambhavi mudra vedasastreshu ghopita// With internalised one-pointed awareness and external gaze unblinking, that truly is shambhavi mudra, preserved in the Vedas. (Chapter -4, Verse 36). Antarlakshyavilinachittapavano Yogi Yada vartate / Drshtya nischalataraya bahir adhah pasyannapasyannapi / Mudreyam khalu sambhavi bhavati sa labdha prasadad ghuroh/ Śunyasunyavilakshanam sphurati tattattvam Padam sambhavam// If the Hatha Yogi remains with the chitta and prana absorbed in the internal object and gaze motionless, though seeing, he is not seeing, this is called shambhavi mudra. When it is bestowed by the guru’s blessing, the state of shoonyashoonya obtained. That is the real state of Shiva consciousness. (Chapter -4, Verse 37) The Unmani Tare jyotishi samyojya kimchidunnamayed bhruvau/ Purvayogam mano yunjannunmanikarakah kshanat// Fix the gaze on the tip of the nose and raise the eyebrows a little, within the mind contemplating, inwardly thinking of Brahma, but apparently looking outside. This will create the Unmani avastha state. Bhrumadhya is the place of Shiva and place of turiya Bhrumadhya is the place of Shiva and place of turiya – Middle of the
Hatha Yoga Pradipika – Chapter Three: Mudra and Bandha
Hatha Yoga Pradipika – Mudra and Bandha -Ten Mudras destroy old age Mahamudra mahabandho mahavedhascha khechari/ Uddiyanam mulabandhas cha bandho jalandharabhidhah//(Chapter -3, Verse 6). Maha Mudra, Maha Bandha, Maha Vedha, Khechari, Uddiyana, Moola Bandha and Jalandhara Bandha. (Chapter -3, Verse 6). #100/200/300/500 hour Yoga teacher training India Karani viparitakhya vajroli saktichalanam/ Idam hi mudradasakam jaramarananasanam//(Chapter -3, Verse 7). Viparita Karani Mudra, Vajroli and Shakti Chalana, truly, these are the ten mudras which destroy old age and death. (Chapter -3, Verse 7). #100/200/300/500 hour Yoga teacher training India (1). Maha Mudra (The Great Attitude) Padamulena vamena yonim sampidya dakshinam/ Prasaritam padam krtva karabhyam dharayeddrdham//(Chapter -3, Verse 10). Press the left heel into the perineum or vagina, straighten the right leg, and with the hands, strongly take hold of the outstretched foot. (Chapter -3, Verse 10). #100/200/300/500 hour Yoga teacher training India Kanthe bandham samaropya dharayed vayum urdhvatah / Yatha dandahatah sarpo dandakarah prajayate//(Chapter -3, Verse 11). By locking the throat and holding the breath, the prana rises straight, just like a snake beaten with a stick becomes straight. (Chapter -3, Verse 11). Rjvibhuta tatha saktih kundali sahasa bhavet/ Tada sa maranavastha jayate dviputasraya//(Chapter -3, Verse 12). So the kundalini sakti becomes very straight at once. Then the ida and pingala nadi become lifeless as the sakti enters into the sushumna nadi. (Chapter -3, Verse 12). Tatah sanaih sanaireva rechayennaiva veghatah/ Mahamudram cha tenaiva vadanti vibudhottamāh//(Chapter -3, Verse 13). Then breathe out slowly and gradually, not quickly. Indeed this is explained as maha mudra by the great siddhas. (Chapter -3, Verse 13). (2).Maha Bandha (Great Lock) Parshnim vamasya padasya yonisthane niyojayet/ Vamorupari samsthapya dakshinam charanam tatha// Press the heel of the left foot in the perineum or vagina and place the right foot on the left thigh. (Chapter -3, Verse 19). #100/200/300/500 hour Yoga teacher training India Purayitva tato vayum hrdaye chubukam drdham/ Nishpidya yonimakunchya manomadhye niyojayet// Thus breathing in, bring the chin to the chest strenum bone, Jalandhara Bandha, constrict the perineal or cervical region as moola bandha and focus on the eyebrow center known as shambhavi mudra). (Chapter -3, Verse 20). Dharayitva yathasakti rechayedanilam sanaih / Savyangghe tu samabhyasya dakshangghe punarabhyaset// Having holding the breath as long as feeling comfortable, then breathe out slowly. Once completing the practice on the left side, practice again on the right side too.(Chapter -3, Verse 21). Matamatra tu keshamchitkanthabandham vivarjayet/ Rajadantasthajihvaya bandhah sasto bhavediti// Some of them think that the throat lock Jalandhara Bandha is unnecessary and it is sufficient to keep the tongue against the front teeth. (Chapter -3, Verse 22). #100/200/300/500 hour Yoga teacher training India Kalapasamahabandhavimochanavichakshanah/ Trivenisangghamam dhatte kedaram prapayenmanah// Maha bandha release one from the bonds of death, makes the three nadis join together in Ajna chakra and enables the mind to attain the sacred state of Shiva, Kedara. (Chapter -3, Verse 24). (3). Maha Vedha Mudra (Great Piercing Attitude) Atha mahavedhah Mahabandhasthito yogi krtva purakam ekadhih/ Vayunam ghatimavrtya nibhrtam kanthamudraya// The Hatha Yogi, in the position of Maha Bandha, should breath in, make the mind steady and hold the movement of prana by doing the throat lock. (Chapter -3, Verse 26). #100/200/300/500 hour Yoga teacher training India Samahastayugho bhumau sphichau sanadayechchanaih/ Putadvayam atikramya vayuh sphurati madhyaghah// Placing the palms of the hands on the ground, he should slowly beat the bumps gently on the ground. The prana then leaves the two nadis ida and pingala and enters into the middle channel sushumna nadi. (Chapter -3, Verse 27). Mahavedhoa yam abhyasan mahasiddhipradayakah/ Valipalitavepaghnah sevyate sadhakottamaih// This is maha vedha, and by practicing its benefited great perfections. Wrinkles, grey hair and the trembling of old age are avoidable, thus the best of practitioners devote themselves to it. (Chapter -3, Verse 29). Khecharya mudritam yena vivaram lambikordhvatah/ Na tasya ksharate binduh kaminyasleshitasya cha// Even when there is movement of the bindu and it enters the genitals, it is catched by closing the perineum and is taken upward direction. (Chapter -3, Verse 43). Sushiram jnanajanakam panchasrotah samanvitam/ Tishthate khechari mudra tasminsunye niranjane// Five nadis unite in this cavity and it is the root source of knowledge. Khechari should be established in that void, untainted by ignorance. (Chapter -3, Verse 53). (4). Uddiyana Bandha (Abdominal Retraction Lock) #100/200/300/500 hour Yoga teacher training India Atha uddiyanabandhah Baddho yena sushumnayam pranastuddiyate yatah/ Tasmad uddiyanakhyoa yam yoghibhih samudahrtah// Uddiyana bandha is so-called by the yogis because through its practice the prana (is concentrated at one point and) rises through sushumna. (Chapter -3, Verse 55). Uddinam kurute yasmadavisrantam mahakhaghah/ Uddiyanam tadeva syattatra bandho abhidhiyate// The bandha explained is called the rising or flying bandha, because through its practice, the great bird Shakti flies upward with ease and comfortably. (Chapter -3, Verse 56). #100/200/300/500 hour Yoga teacher training India Udare paschimam tanam nabherurdhvam cha karayet / Uddiyano hyasau bandho mrtyumatangghakesari// Sucking the abdomen back in and making the navel rise is called Uddiyana Bandha. It is the lion which conquers the elephant death. (Chapter -3, Verse 57). (5). Moola Bandha(perineum/cervix retraction lock) Atha mulabandhah Parshnibhaghena sampidya yonim akunchayed ghudam/ Apanam urdhvam akrshya mulabandho abhidhiyate// Pressing the perineum/vagina with the heel and contracting the rectum so that the apana vayu moves upward it’s called moola bandha. (Chapter -3, Verse 61). #100/200/300/500 hour Yoga teacher training India Adhogatim apanam va urdhvagam kurute balat/ Akunchanena tam prahur mulabandham hi yoginah// By contracting the perineum the downward moving apana vayu is forced to go upward. Hatha Yogis called it as Moola Bandha. (Chapter -3, Verse 62). Gudam parshnya tu sampidya vayumakunchayed balat/ Varam varam yatha chordhvam samayati samiranah// Press the heel strongly against the rectum and contract forcefully and repeatedly, so that the prana energy rises. (Chapter -3, Verse 63). Pranapanau nadabindu mulabandhena chaikatam/ Gatva yogasya samsiddhim yachchato natra samsayah// There is no doubt that by practicing moola bandha, prana/apana and nada/bindu are joined, and total perfection gained.64 (6). Jalandhara Bandha (throat lock) Atha jalandharabandhah Kanthamakunchya hrdaye sthapayechchibukam drdham/ Bandho jalandharakhyoayam jaramrtyuvinasakah// Contracting the throat by bringing the chin to the chest sternum bone is the bandha called Jalandhara Bandha. It
Hatha Yoga Pradipika – Chapter Two: Shatkarma and Pranayama
Hatha Yoga Pradipika – Chapter Two: Shatkarma and Pranayama Inter-connection of Mind and Prana and their controlling through Pranayama Chale vate chalam chittam nischale nischalam bhavet / Yogi sthanutvamapnoti tato vayum nirodhayet//(Chapter -2, Verse 2). When Prana moves, chitta the mental force too moves. When prana is still, Chitta also still without any movement. By this steadiness of prana the Hatha Yogi reaches stableness and should thus control the Vayu air. (Chapter -2, Verse 2). #100/200/300/500 hour Yoga teacher training India What is life and death; the functions of five Vayus Yavad vayuh sthito dehe tavaj jivanam uchyate / Maranam tasya nishkrantistato vayum nirodhayet//(Chapter -2, Verse 3). As long as the vayu (air and prana) remains in the body, that is called life. Death is when it leaves the body. Therefore, retain vayu. (Chapter -2, Verse 3). #100/200/300/500 hour Yoga teacher training India Cleansing of the Nadis and Chakras for retention of Prana Suddhameti yada sarvam nadichakram malakulam / Tadaiva jayate yogi pranasamghrahane kshamah//(Chapter -2, Verse 5). When all the nadis and chakras which are full of impurities are cleansed, then the hatha yogi is able to retain prana. (Chapter -2, Verse 5). #100/200/300/500 hour Yoga teacher training India Sattvic quality of mind and the three Gunas for pranayama Pranayamam tatah kuryannityam sattvikaya dhiya / Yatha sushumnanadistha malah suddhim prayanti cha//(Chapter -2, Verse 6). Therefore pranayama should, be practice daily with a sattvic quality of mind so that the impurities are removed out of sushumna nadi and cleanliness occurs. (Chapter -2, Verse 6). Times and duration of practice – Early morning, midday, evening and midnight, holding is step by step held up to eighty counts in one sitting. Pratarmadhyandine sayamardharatre cha kumbhakan/ Sanairasitiparyantam chaturvaram samabhyaset//(Chapter -2, Verse 11). Holding should be practiced perfectly four times a day: early morning, midday, evening and midnight, so that holding is step by step held up to eighty counts in one sitting. (Chapter -2, Verse 11). Signs and symptoms of right Pranayama practice Kaniyasi bhavedsveda kampo bhavati madhyame / Uttame sthanamapnoti tato vayum nibandhayet//(Chapter -2, Verse 12). At first stage there is sweating, in the middle stage trembling, in the last stage complete steadiness, and therefore the breath should be withheld. (Chapter -2, Verse 12). Diet and Pranayama – Milk and Ghee is recommended. At the beginning period of pranayama practice, food, consisting of milk and ghee is recommended very much. Upon being established in the practice such conditions are not necessary at all. (Chapter -2, Verse 14). #100/200/300/500 hour Yoga teacher training India Shatkarma should done before Pranayama if fat and mucus are Excessive Medasleshmadhikah purvam shatkarmani samacharet/ Anyastu nacharettani doshanam samabhavatah//. (Chapter -2, Verse 21). When fat or mucus is too much, shatkarma: the six cleansing practices should be done before pranayama practice. Others, in whom the doshas, i.e. phlegm, wind and bile (vata, pitta, kapha), are balanced should not perform them. (Chapter -2, Verse 21). Shatkarma – Six cleansing practices #100/200/300/500 hour Yoga teacher training India Dhautir bastis tathā netis trātakam naulikam tathā / Kapālabhātiś chaitāni shatkarmāni prachakshate//(Chapter -2, Verse 22). Dhauti, basti, neti, trataka, nauli and kapalbhati; these are called as shatkarma or the six cleansing processes. (Chapter -2, Verse 22). Freedom from the excesses of Doshas through Shatkarma (Chapter -2, Verse 36). By the six karmas (shatkarma) one is freed from excesses of the doshas. Then pranayama is practiced and success is achieved without strain. (Chapter -2, Verse 36). Eight Kumbhaka practices – Suryabheda, Ujjayi, Seetkari, Sheetali, Bhastrika,Bhramari, Moorchha and Plavini. (Chapter -2, Verse 44). #100/200/300/500 hour Yoga teacher training India i sitkari sitali tatha/ Bhastrika bhramari murchcha plavinityashtakumbhakah//(Chapter -2, Verse 44). The eight kumbhakas are suryabheda, ujjayi, seetkari, sheetali, bhastrika, bhramari, moorchha and plavini. (Chapter -2, Verse 44). By Maha Bandha, the Prana moves into the Brahma nadi #100/200/300/500 hour Yoga teacher training India Purakante tu kartavyo bandho jalandharabhidhah/ Kumbhakante rechakadau kartavyastuddiyanakah//(Chapter -2, Verse 45). At the end of inhalation, jalandhara bandha should be performed. At the end of kumbhaka and beginning of exhalation, uddiyana bandha should be performed. (Chapter -2, Verse 45). Adhastatkunchanenasu kanthasangkochane krte/ Madhye paschimatanena syatprano brahmanadighah//(Chapter -2, Verse 46). By contracting the perineum, contracting the throat and sucking the abdomen up, the prana moves into the brahma nadi. (Chapter -2, Verse 46). Pranayama three types, rechaka, pooraka, and kumbhaka. Pranayamas tridha prokto rechapurakakumbhakaih / Sahitah kevalascheti kumbhako dvividho matah// (Chapter -2, Verse 71). Pranayama is said to be of three types: exhalation (rechaka), inhalation (pooraka), and retention (kumbhaka). Kumbhaka is again of two types: connected sahita and unconnected kevala. (Chapter -2, Verse 71). #100/200/300/500 hour Yoga teacher training India Yavat kevalasiddhih syat sahitam tavad abhyaset/ Rechakam purakam muktva sukham yadvayudharanam//(Chapter -2, Verse 72). Till attain perfection in kevala kumbhaka, sahita kumbhaka has to be practiced. When you are freed of inhalation/exhalation then the breath/prana is ceased spontaneously. (Chapter -2, Verse 72). Pranayamoa yam ityuktah sa vai kevalakumbhakah/ Kumbhake kevale siddhe rechapurakavarjite//(Chapter -2, Verse 73). Perfection of isolated holding is freedom from inhalation and exhalation process. This pranayama spoken of is verily kevala kumbhaka. (Chapter -2, Verse 73). Na tasya durlabham kimchittrishu lokeshu vidyate/ Saktah kevalakumbhena yatheshtam vayudharanat//(Chapter -2, Verse 74). Nothing in the three worlds of existence is unobtainable by him who has mastery over kevala kumbhaka and can hold the breath as desired time. (Chapter -2, Verse 74). #100/200/300/500 hour Yoga teacher training India
Introduction to Human Anatomy and Physiology
Introduction to Human Anatomy and Physiology Anatomy #100/200/300/500 hour Yoga teacher training India It is the science that deals with the structures of the human body and its relationship of various parts to each other. The subject matter of anatomy includes Histology – Study of tissues Osteology – Study of bones Mycology – Study of muscles Arthrology – Study of Joints Splanchnology – Study of organs Neurology – Study of Nervous System Physiology #100/200/300/500 hour Yoga teacher training India It is the science which deals with the functions of the body. It explains how various systems in the body function together normally as a single unit. The subject matter of physiology includes the study of various systems like. Central nervous system Cardio vascular system Digestive system Excretory system Respiratory system Reproductive system etc., Cell #100/200/300/500 hour Yoga teacher training India Each and every part of our body is composed of tiny microscopic units, the Cell. Cell is the structural and functional unit of the body. Cells have different shapes and sizes according to their nature of work Tissues #100/200/300/500 hour Yoga teacher training India Cells are highly organised units but they do not function in isolation. They work together in a group of similar cells called tissue. Every tissue has got its specialized function to perform. TYPES Epithelial tissue Connective tissue Muscular tissue Nervous tissue Epithelial Tissue It covers the body surfaces and forms gland. It forms external layer of the skin, internal living the mucus membrane of the body cavities and the hollow organs. Functions Secretion Protection Absorption Excretion Connective Tissue #100/200/300/500 hour Yoga teacher training India It includes the blood cells, loose and dense (fiber) connective tissue, adipose tissue, lymph cartilages and bones. Major function of connective tissue is to connect, anchor and support the other tissues of the body and to form structural frame work of the body. Muscular Tissue #100/200/300/500 hour Yoga teacher training India It is responsible for movements of the body and organs. This is because of its characteristic function of contraction. It forms mainly three types of muscle fibres. Cardiac muscle Smooth muscle Striated or Skeletal muscle Functions #100/200/300/500 hour Yoga teacher training India Motion is an essential body function which results from the contraction and relaxation of muscles. Maintenance of posture and Heat production. Nervous Tissue It forms the whole nervous system. It initiates and transmits nerve impulses that coordinate the body and its surrounding environment. The main properties of this tissue are excitability and conductivity nervous tissue responds to various stimuli. Nervous tissue is composed of nerve cells and their processes. These processes born the nerve fibers. Such unit of nervous tissue is known as neuron. They construct the nerves in the body. Organs #100/200/300/500 hour Yoga teacher training India Different kinds of tissues are joined together to form higher level of organisation. i.e. organ Organs have recognizable shape. Each organ has a complex structure and it performs a specific function of the body. Examples Liver, Heart, Brain, Lungs, Stomach ete System #100/200/300/500 hour Yoga teacher training India A system is an association of organs that have a common function. Types and various systems in the human body There are 11 major systems such as Skeletal system Muscular System Digestive system Respiratory system Nervous system Circulatory System Urinary System Endocrine system Reproductive system Integument system Immune system #100/200/300/500 hour Yoga teacher training India
Need of Anatomy and Physiology in Yoga
Need of Anatomy and Physiology in Yoga #100/200/300/500 hour Yoga teacher training India Knowledge of anatomy and physiology forms the basis for the study of biological sciences. Even for a common man, to understand the heath problems and their solution. Preliminary knowledge of this subject is helpful. Today yogic practices have become popular throughout the world. The yogic practices have been included in school and college curriculum where yoga teacher imparts the yoga training consisting of mainly asanas, pranayamas and kriyas etc. These practices involve our bodily structure and function. In order to understand how the yogic practices influence our body and mind, a student and teacher should know the basic anatomy and physiology as well as the physiological changes brought about by the yogic practices. Having this knowledge, one will be able to employ the technique systematically for the students or the patients. The importance of this subject was realized by the concerned authorities and now this subject has been introduced in the field of education and other faculties. #100/200/300/500 hour Yoga teacher training India The whole approach in studying the basic principles of anatomy and physiology is to understand the probable mechanisms involved in various yogic practices on the scientific background. It is obvious that our body responds according to the nature of stimulation from the external or the internal environments. Yogic practices work deep inside the body and mind and are expected to bring about some changes in the behavioral pattern of even a normal individual so as to prepare him for the higher yogic practices. There fore our yogic techniques should bear a scientific background along with the traditional support. This scientific background would also help the individual to remove confusion or misconception. If any, regarding the technique and the results of the yogic practices. He would then be the best yoga teacher to guide his students on the path of yoga. #100/200/300/500 hour Yoga teacher training India
Hatha Yoga Pradipika – Who can practice Yoga?
Hatha Yoga Pradipika – Who can practice Yoga? Yuvo vrddhoativrddho va vyadhito durbaloapi va / Abhyasat siddhim apnoti sarvayogheshvatandritah//(Chapter -1, Verse -64). Either, Young or old, very old, sick or feeble, one can attain perfection in all the Yogas by regular constant practicing. (Chapter -1, Verse – 64). #100/200/300/500 hour Yoga teacher training India
Hatha Yoga Pradipika – Food conducive for Hatha Yogic Practices
Hatha Yoga Pradipika – Food conducive for Hatha Yogic Practices Ghodhuma-sali-yava-shashtika-sobhanannam / Kshirajyakhanda-navanitasi hamadhuni// Sunthipatolakaphaladikapanchasakam / Mudghadidivyam udakam cha yamindrapathyam//(Chapter -1, Verse -62). #Yoga course Bangalore The most supporting foods for the Hatha Yogic practices are: good grains, wheat, rice, barley, milk, ghee, brown sugar, sugar candy (crystallized sugar), honey, dry ginger, patola fruit (species of cucumber), five vegetables, mung, pulses, and pure water. (Chapter -1, Verse -62). #Yoga course Bangalore Pushtam sumadhuram snighdham Gavyam dhatupraposhanam / Manobhilashitam yoghyam yogi bhojanamacharet//(Chapter -1, Verse-63). The Hatha Yogi should take nourishing and sweet food mixed with, ghee and milk; it should nourish the dhatus (basic body constituents) and be pleasing and suitable for body-mind-soul. (Chapter -1,Verse-63). #Yoga course Bangalore
Hatha Yoga Pradipika – Food Prohibited for Hatha Yogic Practices
Hatha Yoga Pradipika – Food Prohibited for Hatha Yogic Practices Katvamla-tikshna-lavanoshna-haritasaka / Sauvira-taila-tila-sarshapa-madya-matsyan // Ajadi-mamsa-dadhi-takra-kulattha-kola / Pinyaka-hingghu-lasunady-amapathyam-ahuh//(Chapter -1, Verse- 59). #Yoga course Bangalore The foods which prohibited for the Hatha Yogic practitioners are: those which are bitter, sour, pungent, salty, heating, green vegetables, sour gruel, oil, sesame and mustard, alcohol, fish, flesh foods, curds, buttermilk, horse gram, fruit of jujube, oil cakes, asafetida and garlic. (Chapter -1, Verse- 59). Bhojanam ahitam vidyāt punarasyoshnīkrtam rūksham/ Atilavanamam layuktam kadaśanaśākotkam varjyam// (Chapter -1, Verse -60). #Yoga course Bangalore Unnourishing food should not be consumed, that which is reheated after becoming cold, which is dry (devoid of natural oil), which is excessively salty or acidic, stale or has too many mixed vegetables. (Chapter -1, Verse -60). #Yoga course Bangalore
Hatha Yoga Pradipika -Moderate diet for Hatha Yogic Practices
Hatha Yoga Pradipika -Moderate diet for Hatha Yogic Practices Susnighdhamadhuraharaschaturthamsavivarjitah / Bhujyate sivasamprityai mitaharah sa uchyate//(Chapter -1, Verse -58). Mitahara is defined as agreeable and sweet food, leaving one fourth of the stomach free, and eaten. (Chapter -1, Verse-58). #Yoga course Bangalore
Hatha Yoga Pradipika – Four best asanas according to Shiva
Hatha Yoga Pradipika – Four best asanas according to Shiva Four best asanas among eighty four taught by Shiva Chaturasityasanani sivena kathitani vai / Tebhyas chatushkam adaya sarabhutam bravimyaham//(Chapter -1, Verse -33) Among all the eighty-four Asanas were taught by Shiva. Out of those ‘I’ shall now describe the four important Asanas. (Chapter -1, Verse-33) #200 hour Yoga teacher training certificate course in Bangalore Siddham padmam tatha simham bhadram veti chatushtayam/ Sreshtham tatrapi cha sukhe tishthetsiddhasane sada//(Chapter -1, Verse-34) Siddhasana, padmasana, simhasana and bhadrasana, these are the four essential Asanas. Always sit comfortably in Siddhasana because it is the bestamong all the asanas. (Chapter -1, Verse-34) #200 hour Yoga teacher training certificate course in Bangalore (1). Siddhasana (Adept’s Pose) Yonisthanakam angghrimulaghatitam Krtva drdham vinyaset / Mendhre padam athaikameva hrdaye Krtva hanum susthiram // Sthanuh samyamitendriyoa chaladrsa pasyed bhruvor antaram/ Hyetan mokshakapatabhedajanakam Siddhasanam prochyate//(Chapter -1, Verse -35) #200 hour Yoga teacher training certificate course in Bangalore Press the perineum with the heel of one foot, place the other foot on top of the genitals. Having done this, rest the chin on to the chest. Remaining still and steady, with the senses controlled, gaze steadily into the eyebrow center; it breaks open the door to liberation. This is called siddhasana. (Chapter -1, Verse -35). #200 hour Yoga teacher training certificate course in Bangalore (2). Padmasana (lotus pose) Vamorupari dakshinam cha charanam Samsthapya vamam tatha / Dakshorupari paschimena vidhina Dhrtva karabhyam drdham // Angghushthau hrdaye nidhaya Chibukam nasaghramalokayet / Etadvyadhivinasakari yaminam Padmasanam prochyate//(Chapter -1, Verse 44) Place the right foot on the left thigh and the left foot on the right thigh, cross the hands behind the back and firmly hold the toes. Press the chin against the chest and look at the tip of the nose. This is called padmasana, the destroyer of a yogi’s diseases. (Chapter -1, Verse- 44). Uttanau charanau krtva urusamsthau prayatnatah / Urumadhye tathottanau pani krtva tato drsau//(Chapter -1, Verse-45) Place the feet on the thighs, soles upward, palms in the middle of the groin, facing upward. (Chapter -1, Verse-45). Nasaghre vinyasedrajadantamule tu jihvaya/ Uttambhya chibukam vakshasyutthapy pavanam sanaih//(Chapter -1, Verse-46) Gaze at the nose tip, keeping the tongue pressed against the root of the upper teeth and the chin against the chest, and slowly raise the prana upward. (Chapter -1, Verse-46) Idam padmasanam proktam sarvavyadhivinasanam/ Durlabham yena kenapi dhimata labhyate bhuvi//(Chapter -1, Verse-47) This is called padmasana, destroyer of all diseases. Ordinary people cannot achieve this posture, only the few wise ones on this earth can do. (Chapter -1, Verse -47) (3). Simhasana (lion’s pose) Ghulphau cha vrshanasyadhah Sivantyah parsvayoh kshipet/ Dakshine savyaghulpham tu Dakshaghulpham tu savyake//(Chapter -1, Verse-50). Place the ankles below the scrotum, right ankle on the left side, left ankle on the right side of the perineum. (Chapter -1,Verse-50). Hastau tu janvoh samsthapya Svangghulih samprasarya cha / Vyattavaktro niriksheta nasaghram susamahitah// (Chapter -1, Verse-51). Place the palms on the knees, fingers spread apart, keep the mouth open and gaze at the nose tip with a concentrated mind.(Chapter -1, Verse-51). #200 hour Yoga teacher training certificate course in Bangalore Simhasanam bhavedetatpujitam yoghipungghavaih / Bandhatritayasandhanam kurute chasanottamam//(Chapter -1, Verse-52). This is simhasana, held in great esteem by the highest yogis. This most excellent asana facilitates the three bandhas. (Chapter -1, Verse-52). (4). Bhadrasana (gracious pose) Ghulphau cha vrshanasyadhah Sivantyah parsvayoh kshipet / Savyaghulpham tatha savye Dakshaghulpham tu dakshine // Parsvapadau cha panibhyam Drdham baddhva sunischalam / Bhadrasanam bhavedetatsarvavyadhivinasanam //(Chapter -1, Verse- 53). #200 hour Yoga teacher training certificate course in Bangalore Place the ankles below the genitals on the sides by the perineum, left ankle on the left (side) right ankle on the right (side).(Chapter -1, Verse- 53). Ghorakshasanamityahuridam vai siddhayoghinah/ Evamasanabandheshu yogindro vighatasramah // Abhyasennadikasuddhim mudradipavanakriyam/(Chapter -1, Verse-54). Then hold the feet, which are on their sides, firmly with the hands and remain motionless. This is bhadrasana which destroys all diseases. The yogis who are perfected (siddhas) call it gorakshasana. (Chapter -1, Verse-54). #Yoga course Bangalore