Skip to main content

Best Yoga Teacher Training in Bangalore, India | Yoga Alliance USA | Accredited

karuna yoga vidya peetham logo

Blog

-
Blog

Attainment of pure consciousness- Kaivalya Pada-Patanjali Yoga Sutra

Patanjali Yoga Sutra – Kaivalya Pada Attainment of pure consciousness or kaivalya 4.34. Purusarthasunyanam gunanam pratiprasavah kaivalyam svarupapratistha va chitisakteriti| Purusartha-purpose of the purusha Sunyanam-devoid of Gunanam-of the gunas Pratiprasavah-involution Kaivalyam-liberation Svarupa-ones own nature Pratistha-establishment Va-or Chitisakteh-purusah Iti-that’s all(denotes the end of the Patanjali Yoga Sutra) Kaivalya is the involution of the gunas because of the fulfilment of their objectives or it is the restoration of the purusha to its inherent  form which is called pure consciousness.  

Read More »

Confusion of memories-Kaivalya Pada-Patanjali Yoga Sutra

Patanjali Yoga Sutra – Kaivalya Pada Confusion of memories 4.21. Chittantaradrsye buddhibuddheratiprasangah smrtisankarascha| Chittantaradrsye-in one mind being cognized by the other Buddhibuddheh-cognition of cognitions Atiprasangah-absurd superfluity Smrti-memory Sankarah-confusion Cha-and If cognition by one mind of th eother be accepted, then there will be cognition of cognitions leading to absurdity and confusion of memory.  

Read More »

Mind & object – Kaivalya Pada – Patanjali Yoga Sutra

  Patanjali Yoga Sutra – Kaivalya Pada Mind & object 4.16. Na chaika chittatantram vastu tadapramanakam tada kim syat| Na-not Cha-and Eka-one Chitta-mind Tantram-dependent Vastu-object Tat-that Apramanakam-non-cognized Tada-then Kim-what Syat-would happen The object of perception is not dependent on the chitta, what would happen to the object of perception when the medium of cognition is not there?. Patanjali Yoga Sutra – Kaivalya Pada Reflection of object 4.17. Taduparagapeksitvachchittasya vastu jnatajnatam| Taduparaga-the reflection of the object in chitta Apeksitvat-because of necessity Chittasya-of the mind Vastu-object Jnata-known Ajnatam-unknown The mind needs the reflection of the objects for its cognition.  

Read More »

Purusha knows the mind-Kaivalya Pada-Patanjali Yoga Sutra

Patanjali Yoga Sutra – Kaivalya Pada Purusha knows the mind 4.18. Sada jnatascittavrttayastatprabhoh purusasyaparinnamitvat| Sada-always Jnatah-are known Chittavrttayah-modifications of mind Tatprabhoh-on its master Purusasya-of the purusha Aparinamitvat-due to changelessness Purusha, the master of chitta, is chnageless, therefre, he always knows the modifications of the mind.  

Read More »

What is  perception ? – Kaivalya Pada-Patanjali Yoga Sutra

Patanjali Yoga Sutra – Kaivalya Pada What is  perception ? 4.15. Vastusamye chittabhedattayovibhaktah panthah| Vastusamye-by sameness of the object Chittabhedat-by the difference of the mind Tayoh-of these two vibhaktah –separate panthah-path of manifestation Because of the sameness of object and difference of mind their ways are different.

Read More »

Dominance of action or karma- Kaivalya Pada – Patanjali Yoga Sutra

Patanjali Yoga Sutra – Kaivalya Pada –  Dominance of action or karma 4.7. Karmasuklakrsnam yoginastrividhamitaresam| Karma-action Asukla-not white Akrsnam-not black Yoginah-of the yogis Trividham-threefold Itaresam-of others The deed of yogis are neither white nor black, of others they are threefold. Patanjali Yoga Sutra – Kaivalya Pada Exhibition of potential desires 4.8. Tatastadvipakanugunanamevabhivyaktirvasanam| Tatah-therefrom Tadvipaka-the ripening of those Anugunanam-accordingly Eva-only Abhivyaktih-manifestation Vasanam-of potential desires Therefrom the exhibition of potential desires according to their activities, ripening only.  

Read More »

Vanishing of impressions-Kaivalya Pada -Patanjali Yoga Sutra

Patanjali Yoga Sutra – Kaivalya Pada Vanishing of impressions 4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah| Hetu-cause Phala-effect Asraya-support Alambanaih-object Sangrhitatvat-because of being bound together Esam-of these Abhave-on the disappearance Tadabhavah-their disappearance Since cause and effect, support and object are act together, by their disappearance that also disappears. Patanjali Yoga Sutra – Kaivalya Pada Past & future exist 4.12. Atitanagatam svarupo’styadhvabhedadharmanam| Atita-past Anagatam-future Svarupatah-in its essential form Asti-exists Adhvabhedat dharmanam- of inherent properties Past and future exist in their own form by difference of paths. Patanjali Yoga Sutra – Kaivalya Pada Reason for existence 4.13. Te vyaktasuksma gunatmanah| Te-they Vyakta-manifest Suksma-subtle Gunatmanah-of the nature of gunas Whether manifest or unmanifest they are of the nature of gunas.  

Read More »

Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions

Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions 4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat| Jati-class of birth Desa-place Kala-time Vyavahitanam-separated Api-even Anantaryam-sequence Smrtisamskarayoh-of memory and impressions Ekarupatvat-because of sameness in form Because memory and impression are the same in form there is a sequence although they may be classified by class of birth, place and time. Patanjali Yoga Sutra – Kaivalya Pada Source of potential impressions 4.10. Tasamanaditvam chasiso nityatvat| Tasam-there is Anaditvam-begnninglessness Cha-and Asisah-of the will to live Nityatvat-by permanence There is no beginning to them and the desire to live is eternal.  

Read More »

Heart, Arteries & Veins Forms the Circulatory System

The Heart, Arteries & Veins Forms the Circulatory System:  The heart pumps blood into arteries. The arteries divide and subdivide and finally end in capillaries. The capillaries later unite to form veins. The veins return blood to the heart. The arteries carry pure blood away from the heart, Veins carry De-oxygenated blood to the heart and the capillaries are minute channels receives blood from smaller arteries (arterioles) and deliver into smaller veins (venules).  Blood circulation: depending on the course of blood. Circulation can be classified into: Systemic circulation. Pulmonary circulation Coronary circulation Portal circulation. Systemic circulation: it’s  the blood circulation that carries oxygenated blood away from the heart, to the body, and returns deoxygenated blood back to the heart except for lungs. This circulation starts Oxygenated blood enters the left atrium from the pulmonary veins. The blood is then pumped through the mitral valve into the left ventricle. From the left ventricle, blood is pumped through the aortic valve and into the aorta, the body’s largest artery. The aorta arches and branches into major arteries and then it breaks up into smaller arteries and finally ends in capillaries. The capillaries unite to form venules which join up ultimately to form 2 large venous trunks namely superior vena cava and inferior vena cava. These 2 venous trunks open in the right atrium of the heart.  Gas and nutrient exchange with the tissues occurs within the capillaries that run through the tissues. Metabolic waste and carbon dioxide diffuse out of the cell into the blood, while oxygen and glucose in the blood diffuse out of the blood and into the cell. The arterial component of systemic circulation the highest blood pressures in the body. The venous component of systemic circulation has considerably lower blood pressure in comparison, due to their distance from the heart, but contain semi-lunar valves to compensate. Systemic circulation as a whole is a higher pressure system than pulmonary circulation. Pulmonary circulation: it involves the purification of blood in lungs. It’s the circulation of the blood from the heart to the lungs for oxygenation, then back to the heart again. The Oxygen-depleted blood from the body leaves the systemic circulation when it enters the right atrium, The blood is then pumped through the tricuspid valve into the right ventricle. From the right ventricle, blood is pumped through the pulmonary valve and into the pulmonary artery. The pulmonary artery splits into the right and left pulmonary arteries and travel to each lung. The oxygenated blood then leaves the lungs through pulmonary veins, which returns it to the left atrium, completing the pulmonary circulation. Coronary Circulation: Coronary circulation involves blood supply to the heart itself, it is the circulation of blood in the blood vessels of the heart muscle. The vessels that deliver oxygen-rich blood to the myocardium are known as coronary arteries. The right and left coronary arteries arise from ascending aorta.  The vessels that remove the deoxygenated blood from the heart muscle are known as cardiac veins which collect and opens into the right atrium. Portal circulation: It’s the circulation of blood through the liver. In this circulation, the portal vein carries blood that has circulated in stomach, intestine, and pancreas to liver. The portal vein divides into capillaries. These capillaries join with the capillaries of the hepatic artery. The venous blood of liver is collected by hepatic vein which joins with inferior vena cava.  

Read More »

Measurement of blood pressure

Measurement of blood pressure:  Blood pressure is usually measured by an instrument called sphygmomanometer; it consists of a mercury manometer. Cuff and hand pump. The cuff is tied around the cubical fossa of the individual then the hand pump is pressed so that air is inflated in the cuff. When the cuff is fully inflated, air pressure is more than blood pressure. So blood flow in the brachial artery is completely obstructed. Now the hand pump is slowly released until the time the appearance of the first sound is heard (by means of a stethoscope put in the cubital fossa*. The manometer reading is now noted this regarding the systolic pressure. Later the hand pump is slowly released until the time that the sound becomes louder and louder. Later it stops the manometric reading is noted when the sound disappears. This reading is the diastolic blood pressure.

Read More »

Unmani Avastha State

Unmani Avastha Tare jyotishi samyojya kimchidunnamayed bhruvau/ Purvayogam mano yunjannunmanikarakah kshanat// Fix the gaze on the tip of the nose and raise the eyebrows a little, within the mind contemplating, inwardly thinking of Brahma, but apparently looking outside. This will create the Unmani avastha state.

Read More »

Sound-Shakti – Dissolves in Consciousness

Sound is shakti and dissolves in consciousness Yatkinchin nadarupena sruyate saktireva sa / Yas tattvanto nirakarah sa eva paramesvarah// Whatever is heard of the nature of the mystical nada or sound is verily Shakti. That in which all the panchatattwa elements find dissolution, that is the formless being, the supreme God. (Chapter -4, Verse 102).

Read More »

Shambhavi Mudra (eyebrow center gazing)

Shambhavi Mudra (eyebrow center gazing) Shambhavi mudra (eyebrow center gazing) internalizes pranic flow and mind – If the Hatha Yogi remains with the chitta and prana absorbed in the internal object and gaze motionless, though seeing, he is not seeing, this is called shambhavi mudra, realm of Shiva consciousness). Antarlakshyam bahirdrshtir nimeshonmeshavarjita / Esha sa sambhavi mudra vedasastreshu ghopita// With internalised one-pointed awareness and external gaze unblinking, that truly is shambhavi mudra, preserved in the Vedas. (Chapter -4, Verse 36).   Antarlakshyavilinachittapavano Yogi Yada vartate / Drshtya nischalataraya bahir adhah pasyannapasyannapi / Mudreyam khalu sambhavi bhavati sa labdha prasadad ghuroh/ Śunyasunyavilakshanam sphurati tattattvam Padam sambhavam//   If the Hatha Yogi remains with the chitta and prana absorbed in the internal object and gaze motionless, though seeing, he is not seeing, this is called shambhavi mudra. When it is bestowed by the guru’s blessing, the state of shoonyashoonya obtained. That is the real state of Shiva consciousness.  (Chapter -4, Verse 37)      

Read More »

Prana and Mind

Prana and mind are controlled through each other Pavano badhyate yena manastenaiva badhyate / Manascha badhyate yena pavanastena badhyate// Through controlling the prana, thought is contolled and through control of thought, prana or air is controlled. (Chapter -4, Verse 21).

Read More »

Parichaya Avastha (stage of increase)

Parichaya Avastha (stage of increase) Stage of increase – Sound of the drum, perfection or siddhi. Imbalance of the three humors or doshas, pain, old age, disease, hunger, sleep are destroyed. Trtiyayam tu vijneyo vihayo mardaladhvanih / Mahasunyam tada yati sarvasiddhisamasrayam// In the third stage is the experience of the sound of the drum. Then there is the great emptiness and one enters the place of total perfection or siddhi. (Chapter -4, Verse 74).   Chittanandam tada jitva sahajanandasambhavah / Doshaduhkhajaravyadhikshudhanidravivarjitah// Then the bliss of chitta being obtained, spontaneous ecstasy arises. Imbalance of the three humours or doshas, pain, old age, disease, hunger, sleep are destroyed. (Chapter -4, Verse 75).      

Read More »

Main bones of the human skeleton

The main bones of the human skeleton are: The Skull – Cranium, Mandible, and Maxilla Shoulder girdle – clavicle and scapula Arm – humerus, radius, and ulna Hand – Carpals, Metacarpals, and Phalanges Chest – Sternum, and Ribs Spine – Cervical area (top 7 vertebrae), Thoracic (next 12), Lumbar (bottom 5 vertebrae), Sacrum (5 fused or stuck together bones) and Coccyx (the tiny bit at the bottom of the spine). Pelvic girdle – Ilium, Pubis, and Ischium. Leg – Femur, Tibia, and Fibula Ankle – Talus and calcaneus Foot – Tarsals, Metatarsals, and Phalanges.

Read More »

Nishpatti Avastha (state of consummation)

Nishpatti Avastha (state of consummation) Nishpatti avastha or state of consummation –  Rudra granthi is pierced, the fire of prana flows to the place of Ishwara. Then in the state of nishpatti or consummation is the tinkling sound of the flute resonating like a vina Rudraghranthim yada bhittva sarvapithaghatoanilah/ Nishpattau vainavah sabdah kvanadvinakvano bhavet// If the Rudra granthi is pierced, the fire of prana flows to the place of Ishwara. Then in the state of nishpatti or consummation is the tinkling sound of the flute resonating like a vina.(Chapter -4, Verse 76).

Read More »

Nada anusandhana – exploration of sound “OM”

Nada anusandhana – exploration of sound “OM” Nada anusandhana – exploration of sound”OM” – Closing the ears, nose and mouth, a clear, clear sound is heard in the purified sushumna nadi. Muktasane sthito yogi mudram sandhaya sambhavim/ Śrnuyad dakshine karne nadam antastham ekadhih// The Hatha Yogi, sitting in Muktasana, concentrated in shambhavi mudra, should hear closely to the nada heard within the right ear. (Chapter -4, Verse 67).   Sravanaputanayanayughala Ghranamukhanam nirodhanam karyam /Suddhasushumnasaranau Sphutamamalah sruyate nadah// Closing the ears, nose and mouth, a clear sound is heard in the cleansed sushumna nadi. (Chapter -4, Verse 68).    

Read More »

Mind dissolves in Samadhi

Mind dissolves in Samadhi Mind dissolves in Samadhi – As camphor burnt in fire, and salt mix in the sea, in samadhi mind dissolves into ‘Thatness’ Karpuramanale yadvatsaindhavam salile yatha/ Tatha sandhiyamanam cha manastattve viliyate// As camphor burnt in fire, and salt mix in the sea, in samadhi mind dissolves into ‘Thatness’. (Chapter -4, Verse 59). Knower, known and knowing united Jneyam sarvam pratitam cha jnanam cha mana uchyate/ Jnanam jneyam samam nashtam nanyah pantha dvitiyakah// All that can be known, all that is known and the knowledge, is called mind. When the knower and that which is known are lost together, there is no second way. (Chapter -4, Verse 60).  

Read More »

Mind – Senses, Prana – Mind, Nada – Prana

Mind – Senses, Prana – Mind, Nada – Prana Indriyanam mano natho manonathastu marutah/ Marutasya layo nathah sa layo nadamasritah// Mind is the controller of the senses, prana is the controller of the mind. Dissolution is the lord of the prana and that dissolution, laya is the foundation of nada. (Chapter -4, Verse 29).        

Read More »

Manonmani (consciousness without mind) State

Manonmani (consciousness without mind) State Manonmani (consciousness without mind) – Manonmani is obtained when prana flows in sushumna nadi Sushumnavahini prane siddhyatyeva manonmani/ Anyatha tvitarabhyasah prayasayaiva yoghinam//   When the prana travels in the sushumna nadi this state of manonmani (consciousness without mind) is obtained. Therefore, other forced practices are just laborious to the Hatha Yogi. (Chapter -4, Verse 20).

Read More »

Kundalini at Brahmarandhra Nadi

Kundalini is to be blocked at Brahmarandhra Nadi The ultimate union and samadhi happens at sahasrara chakra. This location is at the crown of the head. The very upper portion of head is called brahmarandhra. The energy and consciousness must remain there, if they gone beyond, there is no return back to the physical body.   Jnatva sushumnasadbhedam krtva vayum cha madhyagham / Sthitva  sadaiva  susthane brahmarandhre nirodhayet// Staying in the most conducive place, having found out how to penetrate sushumna and move the prana through the middle passage, it should be blocked in the brahmarandhra, the center of higher consciousness state.(Chapter -4, Verse 16).  

Read More »

Karma annihilated when prana flows Sushumna Nadi

Karmas get annihilated when prana flows in Sushumna Nadi All Karmas(actions) get annihilated when prana flows in sushumna nadi, mind remain in complete shoonya(void).   Sushumnavahini prane sunye visati manase/ Tada sarvani karmani nirmulayati yogavit// When prana is moving through sushumna nadi, mind is in pure shoonya(void). Then all the karmas of the one knowing yoga are annihilated. (Chapter -4, Verse 12).  

Read More »

Hatha Yogi – Ghata Avastha (vessel stage)

Ghata Avastha (vessel stage) Ghata avastha (vessel stage) – Vishnu granthi is pierced the greatest bliss is revealed. Then from that emptiness the sound of the kettledrum appears.   Dvitiyayam ghatikrtya vayurbhavati madhyaghah / Drdhasano bhaved yogi jnani devasamas tada// In the second stage, when ghata is reached, the Shakti moves into the middle nadi. Being remain in his asana the wise Hatha Yogi is comparable to a divine being. (Chapter -4, Verse 72).   Vishnughranthes tato bhedat paramanandasuchakah / Atisunye vimardas cha bherisabdas tada bhavet// When the Vishnu granthi is pierced the greatest bliss is revealed. Then from that emptiness the sound of the kettledrum appears. (Chapter -4, Verse 73).    

Read More »

Prana and Mind end in Samadhi state

Ending of Prana and Mind in Samadhi state Ending of Prana and Mind in Samadhi state – Activities of prana is annihilated, then mind is reabsorbed in samadhi.   Yada samkshiyate prano manasam cha praliyate/ Tada samarasatvam cha samadhir abhidhiyate// When the activities of Prana are totally annihilated, then mind is reabsorbed in samadhi state achieved. (Chapter -4, Verse 6). Individual soul merge with universal soul, all desires eliminated When Jivatma unites with Paramatma, desires are eliminated   Tatsamam cha dvayoraikyam jivatmaparamatmanoh / Pranashtasarvasangkalpah samadhih so abhidhiyate// When the twofold characteristics of the individual soul and cosmic soul become one, all desires are eliminated and that state is called samadhi. (Chapter -4, Verse 7).    

Read More »

Factors affecting blood pressure

Factors affecting blood pressure: Blood volume. Cardiac output Peripheral resistance. The elasticity of blood vessels. The diameter of the lumen of blood vessels. The viscosity of blood. Blood volume: it’s the total amount of blood in circulation. A sufficient amount of blood in blood vessels is necessary to maintain normal blood pressure loss of blood as in hemorrhage produces a fall in blood pressure. Cardiac output is the quantity of blood pumped by the heart in one minute. It’s the product of stroke volume and the heart rate. An increase in stroke volume increases systolic blood pressure. An increase in cardiac output increases both systolic and diastolic blood pressure. Peripheral resistance: is the resistance offered by blood vessels for the flow of blood. Resistance is offered mainly by small blood vessels, especially arterioles. Elasticity of the arterial walls distends the aorta when the ventricle contracts. The elastic recoils when the ventricle relaxes. This recoiled pushes the blood onwards. The decrease in elasticity as in atheroma produces a rise in blood pressure. 50 The diameter of the lumen of blood vessels: can be altered, narrowing of the lumen increases the resistance to blood flow and this increases blood resistance to blood flow and this increases blood pressure. Enlargement of the lumen has the opposite effect. The viscosity of blood: it’s the blood stickiness. The viscosity of blood spends on plasma, plasma proteins and number of the red blood cells. An increase in viscosity increases blood pressure.  

Read More »

Concentration on nada erase ‘bad karma’

Concentration on nada burns ‘bad karma’ Concentration on nada burns ‘bad karma’ – Bad karma’(sin) is destroyed by constant concentration on nada. The finite mind and prana dissolve into the spotless niranjana. Sada nadanusandhanat  kshiyante papasamchayah/ Niranjane viliyete niśchitam chittamarutau// Sin is eliminated by constant concentration on nada or sound. The finite mind and prana dissolve into the spotless niranjana state. (Chapter -4, Verse 105).          

Read More »

Chitta: Vasana and Prana

Chitta has two qualities: vasana and prana Hetudvayam tu chittasya vasana cha samiranah / Tayorvinashta ekasmintau dvavapi vinasyatah// Chitta has two qualities, vasana and prana. When one of the two is eliminated or deactivated the other also will become inertia. (Chapter -4, Verse 22).  

Read More »

Hatha Yogi-Arambha Avastha (beginning stage)

Arambha Avastha (beginning stage) Arambha avastha (beginning stage) – When the Hatha Yogi experiences arambha in the void of the heart, his body becomes lustrous and brilliant with a divine smell and disease less.   Brahmaghranther bhaved bhedad anandah sunyasambhavah/ Vichitrah kvanako dehe anahatah sruyate dhvanih// The Brahma granthi being pierced, the feeling of bliss arises from the nothingness; wondrous, tinkling sounds and the spontaneous sound anahata are heard within the body. (Chapter -4, Verse 70).   Divyadehas cha tejasvi divyaghandhas tvaroghavan/ Sampurnahrdayah sunya arambhe yogavan bhavet// When the Hatha Yogi feels arambha in the void of the heart, his body becomes lustrous and brilliant with a divine smell and diseaseless. (Chapter -4, Verse 71).      

Read More »

Disorders of Heart

Disorders of Heart Cardiac failure: It’s a condition in which the myocardium of ventricle is unable to maintain sufficient circulation of blood to meet the needs of the body. Depending on onset it may be classified into: 1- Acute failure: when it’s sudden. 2- Chronic failure: when it’s gradual. Stenosis of valves: it’s the narrowing of the valves of the heart. In this condition, the edges of the cusps of the valves become rough. So they stick together and narrow the valvular opening. The incompetence of valves: it’s a functional defect caused by the failure of the valve to close completely. This allows blood to flow back into the ventricle when it relaxes. Angina pectoris: it’s a pain occurring due to myocardial ischemia. It occurs due to narrowing of coronary arteries. Due to this, physical effort causes severe ischemic pain. Myocardial infarction: it’s the death of an area of cardiac tissue due to lack of coronary blood supply to the segment of the myocardium. It occurs due to occlusion of the coronary artery. Cardiac arrhythmia: it’s a disorder in cardiac rate and rhythm. It occurs due to defective impulses formation and defective impulse conduction in the heart.  

Read More »

Vipareeta Karani Mudra (reversing attitude)

Vipareeta Karani Mudra (reversing attitude) Urdhvanabheradhastalorurdhvam bhanuradhah sasi / Karani viparitakha ghuruvakyena labhyate// With the navel region above and the palate below, the sun is above and the moon is below. This is called Viparita Karani, the reversing process. When given by the Guru’s instructions it is fruitful practice. (Chapter -3, Verse 79).   Valitam palitam chaiva shanmasordhvam na drsyate / Yamamatram tu yo nityamabhyasetsa tu kalajit// The practice should be done daily, gradually increasing the duration. After six months of practice, grey hairs and wrinkles become vanished. One who practices it for yama three hours masters or conquers death.(Chapter -3, Verse 82).  

Read More »

Uddiyana Bandha (Abdominal Retraction Lock)

Uddiyana Bandha (Abdominal Retraction Lock) Atha uddiyanabandhah Baddho yena sushumnayam pranastuddiyate yatah/ Tasmad uddiyanakhyoa yam yoghibhih samudahrtah/ Uddiyana bandha is so-called by the yogis because through its practice the prana (is concentrated at one point and) rises through sushumna. (Chapter -3, Verse 55). Uddinam kurute yasmadavisrantam mahakhaghah/ Uddiyanam tadeva syattatra bandho abhidhiyate// The bandha explained is called the rising or flying bandha, because through its practice, the great bird Shakti flies upward with ease and comfortably. (Chapter -3, Verse 56).   Udare paschimam tanam nabherurdhvam cha karayet / Uddiyano hyasau bandho mrtyumatangghakesari// Sucking the abdomen back in and making the navel rise is called Uddiyana Bandha. It is the lion which conquers the elephant death. (Chapter -3, Verse 57).  

Read More »

Moola Bandha(perineum/cervix retraction lock)

Moola Bandha(perineum/cervix retraction lock) Atha mulabandhah Parshnibhaghena sampidya yonim akunchayed ghudam/ Apanam urdhvam akrshya mulabandho abhidhiyate// Pressing the perineum/vagina with the heel and contracting the rectum so that the apana vayu moves upward it’s called moola bandha. (Chapter -3, Verse 61).   Adhogatim apanam va urdhvagam kurute balat/ Akunchanena tam prahur mulabandham hi yoginah// By contracting the perineum the downward moving apana vayu is forced to go upward. Hatha Yogis called it as Moola Bandha. (Chapter -3, Verse 62).   Gudam parshnya tu sampidya vayumakunchayed balat/ Varam varam yatha chordhvam samayati samiranah// Press the heel strongly against the rectum and contract forcefully and repeatedly, so that the prana energy rises. (Chapter -3, Verse 63).                                   Pranapanau nadabindu mulabandhena chaikatam/ Gatva yogasya samsiddhim yachchato natra samsayah//   There is no doubt that by practicing moola bandha, prana/apana and nada/bindu are joined, and total perfection gained.64  

Read More »

Maha Vedha Mudra (Great Piercing Attitude)

Maha Vedha Mudra (Great Piercing Attitude) Atha mahavedhah Mahabandhasthito yogi krtva purakam ekadhih/ Vayunam ghatimavrtya nibhrtam kanthamudraya// The Hatha Yogi, in the position of Maha Bandha, should breath in, make the mind steady and hold the movement of prana by doing the throat lock. (Chapter -3, Verse 26).   Samahastayugho bhumau sphichau sanadayechchanaih/ Putadvayam atikramya vayuh sphurati madhyaghah// Placing the palms of the hands on the ground, he should slowly beat the bumps gently on the ground. The prana then leaves the two nadis ida and pingala and enters into the middle channel sushumna nadi. (Chapter -3, Verse 27). Mahavedhoa yam abhyasan mahasiddhipradayakah/ Valipalitavepaghnah sevyate sadhakottamaih// This is maha vedha, and by practicing its benefited great perfections. Wrinkles, grey hair and the trembling of old age are avoidable, thus the best of practitioners devote themselves to it. (Chapter -3, Verse 29). Khecharya mudritam yena vivaram lambikordhvatah/ Na tasya ksharate binduh kaminyasleshitasya cha// Even when there is movement of the bindu and it enters the genitals, it is catched by closing the perineum and is taken upward direction. (Chapter -3, Verse 43).   Sushiram jnanajanakam panchasrotah samanvitam/ Tishthate khechari mudra tasminsunye niranjane// Five nadis unite in this cavity and it is the root source of knowledge. Khechari should be established in that void, untainted by ignorance. (Chapter -3, Verse 53).  

Read More »

Maha Mudra (The Great Attitude)

Maha Mudra (The Great Attitude) Padamulena vamena yonim sampidya dakshinam/ Prasaritam padam krtva karabhyam dharayeddrdham//(Chapter -3, Verse 10). Press the left heel into the perineum or vagina, straighten the right leg, and with the hands, strongly take hold of the outstretched foot. (Chapter -3, Verse 10).   Kanthe bandham samaropya dharayed vayum urdhvatah / Yatha dandahatah sarpo dandakarah prajayate//(Chapter -3, Verse 11). By locking the throat and holding the breath, the prana rises straight, just like a snake beaten with a stick becomes straight. (Chapter -3, Verse 11).   Rjvibhuta tatha saktih kundali sahasa bhavet/ Tada sa maranavastha jayate dviputasraya//(Chapter -3, Verse 12). So the kundalini sakti becomes very straight at once. Then the ida and pingala nadi become lifeless as the sakti enters into the sushumna nadi. (Chapter -3, Verse 12).   Tatah sanaih sanaireva rechayennaiva veghatah/ Mahamudram cha tenaiva vadanti vibudhottamāh//(Chapter -3, Verse 13). Then breathe out slowly and gradually, not quickly. Indeed this is explained as maha mudra by the great siddhas. (Chapter -3, Verse 13).  

Read More »

Maha Bandha (Great Lock)

Maha Bandha (Great Lock) Parshnim vamasya padasya yonisthane niyojayet/ Vamorupari samsthapya dakshinam charanam tatha// Press the heel of the left foot in the perineum or vagina and place the right foot on the left thigh. (Chapter -3, Verse 19). Purayitva tato vayum hrdaye chubukam drdham/ Nishpidya yonimakunchya manomadhye niyojayet// Thus breathing in, bring the chin to the chest strenum bone, Jalandhara Bandha, constrict the perineal or cervical region as moola bandha and focus on the eyebrow center known as shambhavi mudra). (Chapter -3, Verse 20).   Dharayitva yathasakti rechayedanilam sanaih / Savyangghe tu samabhyasya dakshangghe punarabhyaset// Having holding the breath as long as feeling comfortable, then breathe out slowly. Once completing the practice on the left side, practice again on the right side too.(Chapter -3, Verse 21).   Matamatra tu keshamchitkanthabandham vivarjayet/ Rajadantasthajihvaya bandhah sasto bhavediti// Some of them think that the throat lock Jalandhara Bandha is unnecessary and it is sufficient to keep the tongue against the front teeth. (Chapter -3, Verse 22).   Kalapasamahabandhavimochanavichakshanah/ Trivenisangghamam dhatte kedaram prapayenmanah// Maha bandha release one from the bonds of death, makes the three nadis join together in Ajna chakra and enables the mind to attain the sacred state of Shiva, Kedara. (Chapter -3, Verse 24).    

Read More »

Jalandhara Bandha (throat lock)

Jalandhara Bandha (throat lock) Atha jalandharabandhah Kanthamakunchya hrdaye sthapayechchibukam drdham/ Bandho jalandharakhyoayam jaramrtyuvinasakah// Contracting the throat by bringing the chin to the chest sternum bone is the bandha called Jalandhara Bandha. It eradicates old age and death. (Chapter -3, Verse 70). Badhnati hi sirajalamadhoghami nabhojalam/ Tato jalandharo bandhah kanthaduhkhaughanasanah// That is jalandhara bandha which holds the flow of nectar in the throat. It eliminates all throat ailments. (Chapter -3, Verse 71). Jalandhare krte bandhe kanthasamkochalakshane/ Na piyusham patatyaghnau na cha vayuh prakupyati// Having performed Jalandhara Bandha by contracting the throat, the nectar does not fall into the gastric fire and the prana is not disturbed. (Chapter -3, Verse 72).   Kanthasamkochanenaiva dve nadyau stambhayed drdham/ Madhyachakramidam jneyam shodasadharabandhanam// By firmly contracting the throat, the two nadis, ida and pingala are paralyzed and the sixteen adharas of the manipura chakra are locked. (Chapter -3, Verse 73).            

Read More »
[gravityform id="2" title=false]
Call Back Form