Blog

Patanjali Yoga Sutra – Kaivalya Pada Dominance of action or karma

Patanjali Yoga Sutra – Kaivalya Pada Dominance of action or karma 4.7. Karmasuklakrsnam yoginastrividhamitaresam| Karma-action Asukla-not white Akrsnam-not black Yoginah-of the yogis Trividham-threefold Itaresam-of others The deed of yogis are neither white nor black, of others they are threefold. Patanjali Yoga Sutra – Kaivalya Pada Exhibition of potential desires 4.8. Tatastadvipakanugunanamevabhivyaktirvasanam| Tatah-therefrom Tadvipaka-the ripening of those Anugunanam-accordingly Eva-only Abhivyaktih-manifestation Vasanam-of potential desires Therefrom the exhibition of potential desires according to their activities, ripening only. Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions 4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat| Jati-class of birth Desa-place Kala-time Vyavahitanam-separated Api-even Anantaryam-sequence Smrtisamskarayoh-of memory and impressions Ekarupatvat-because of sameness in form Because memory and impression are the same in form there is a sequence although they may be classified by class of birth, place and time. Patanjali Yoga Sutra – Kaivalya Pada Source of potential impressions 4.10. Tasamanaditvam chasiso nityatvat| Tasam-there is Anaditvam-begnninglessness Cha-and Asisah-of the will to live Nityatvat-by permanence There is no beginning to them and the desire to live is eternal. Patanjali Yoga Sutra – Kaivalya Pada Vanishing of impressions 4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah| Hetu-cause Phala-effect Asraya-support Alambanaih-object Sangrhitatvat-because of being bound together Esam-of these Abhave-on the disappearance Tadabhavah-their disappearance Since cause and effect, support and object are act together, by their disappearance that also disappears. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Past & future exist 4.12. Atitanagatam svarupo’styadhvabhedadharmanam| Atita-past Anagatam-future Svarupatah-in its essential form Asti-exists Adhvabhedat dharmanam- of inherent properties Past and future exist in their own form by difference of paths. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Reason for existence 4.13. Te vyaktasuksma gunatmanah| Te-they Vyakta-manifest Suksma-subtle Gunatmanah-of the nature of gunas Whether manifest or unmanifest they are of the nature of gunas.

June 2, 2017 No Comments

Tags Terms and Conditions Yoga Teacher Training Yoga TTC Yoga Course Terms Student Policies Course Rules Attendance Policy Certification Requirements Yoga Training Institute Yoga School India Karuna Yoga Vidya Peetham Yoga Course Fees Yoga Certification Copyright Policy Training Manual Workshop Terms Yoga Retreat Policy Student Agreement Yoga Education Bangalore Yoga Institute

Patanjali Yoga Sutra – Kaivalya Pada: Pure Mind

Patanjali Yoga Sutra – Kaivalya Pada: Pure Mind 4.4. Nirmanachittanyasmitamatrat| Nirmana-creation Chittani-minds Asmita-egoism Matrat-alone Created minds are free from egoism alone. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Pure mind controls 4.5. Pravrttibhede prayojakam chittamekamanekesam| Pravrtti-activity Bhede-in connection wit the difference Prayojakam-moving Chittam-mind Ekam-one Anekesam-of many The pure mind directs the many in related with the difference of activities. Patanjali Yoga Sutra – Kaivalya Pada Meditative mind is freee from past impressions 4.6. Tatra dhyanajamanasayam| Tatra-there, of them Dhyanajam-born of meditation Anasayam-without the store of past impressions The mind which is born out of meditation, is free of past impression or vasanas. #Online Best yoga certification courses in Bangalore

June 2, 2017 No Comments

Patanjali Yoga Sutra – Kaivalya Pada: Sources of psychic powers

Patanjali Yoga Sutra – Kaivalya Pada: Sources of psychic powers Arise of psychic powers 4.1. Janmausadhimantratapahsamadhijah siddhayah| Janma-birth Ausadhi-herbs Mantra-mantra Tapah-austerity Samadhi-trance Jah-born of Siddhayah-siddhis The siddhis(psychic powers) arises of birth, herbs, mantras, tapas or austerities, or samadhi. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Inherent Transformation 4.2. Jatyantaraparinamah prakrtyapurat| Jatyantara-another birth Parinamah-transformation Prakrti-nature Apurat-by making up, overflowing By the overflow of inherent potentiality creates the transformation from one substance into other substances. Patanjali Yoga Sutra – Kaivalya Pada Instrumental cause 4.3. Nimittamaprayojakam prakrtinam varanabhedastu tatah ksetrikavat| Nimittam-instrument Aprayojakam-indirect Prakrtinam-of various natural tendencies Varana-obstacles Bhedhah-removal Tu-but Tatah-therefore Ksetrikavat-like the farmer The instrumental cause does not stir up the various natures but simply clears the obstacles in the path of transformation. #Online Best yoga certification courses in Bangalore

June 2, 2017 No Comments

HATHA YOGA PRADIPIKA

HATHA YOGA PRADIPIKA The Hatha Yoga Pradipika is compiled by Yogi Swatmarama, an outstanding personality among many authorities of Hatha Yoga i.e. Goraknanath, Gheranda and Srinivasa Bhatta. Hatha Yoga is a very important science for man all the time. The beauty of the Hatha Yoga Pradipika is that it solves a very great problem of every aspirant. The term Hatha is a combination of two big mantras, i.e. Ha & tha where Ha represents mind, the mental energy. That represents prana the vitral force. So Hatha yoga means the union between the pranic and mental force. This is the awakening of higher consciousness. In another description, Ha means moon; that means sun “This is a symbolic of the twin energy forces which exists in everything. It represents the forces of mind, prana or vitality. Which constitute body and mind? The term Pradipika actually means self illuminating or that which illumines. So it is a text which illumines a multitude of physical, mental and spiritual problems for the aspirants. #Online Best yoga certification courses in Bangalore As in yoga, life and consciousness are known as Purusha and Prakriti and in Tantra they are called Shakti and Shiva, similarly in Hatha yoga they are known as Ida and Pingala. In Hatha yoga it begin by saying the one should first purify the whole body the stomach, intestines, nervous system and other systems. By discipline the body the subtle elements, the energy channels (Nadis) within the body should be purified. The behaviour of the vital life force (Prana), the entire nervous system and the various secretions in the body should be properly maintained and harmonized. In this way it will be possible to develop deep meditation. These practices will induce pratyahara and leading dharana dhyana and Samadhi. The main objective of Hatha Yoga is to create an absolute balance of the interacting activities and processes of the physical body, mind and energy. When this balance is created the impulses created give a call of awakening to the control force (Sushmana nadi) which is responsible for the evolution of human consciousness. Therefore it considers Hatha Yoga as the preliminary practice of Tantra, Raja Yoga, Kundalini Yoga and Kriya Yoga. #Online Best yoga certification courses in Bangalore Totally there are four chapters, Chapter I – Asana 67 verses Chapter II – Pranayama and Kriya 78 verses Chapter III – Mudras and Bandhas 130 verses Chapter IV – Samadhi, Nadanusandhana 114 verses Four major sources of Hatha yoga from 6th to 13th century AD. Hatha Yoga Pradipika – Svatmarama Goraksa Samitha – Gorakhnanth Gheranda Samitha – Gheranda Hatha Ratnavali – Srinivasa Bhatta OBJECTIVE Purification and harmonization of Body, Prana and Mind – leading to Raja yoga. Histroical Aspects Vedas & Upanisads – 5000 BC Bhagavad Gita – 300 BC Bhagavata – 1500 BC Patanjali Yoga Sutra – 1800 BC Buddha – 600 BC Jain – 300 BC Hatha Yoga Texts – From 1000 AD to 1600 AD #Online Best yoga certification courses in Bangalore Hatha Yoga Pradipika Four Chapters – Sadanga Yoga 1. On Asanas Yamas & Niyamas – Do’s & Dont’s Asanas – Postures 2. On Pranayamas Shatkriyas – Cleansing techniques Pranayamas – Mastery over prana 3. On Mudras Bandhas – Locks Mudras – Symbols 4. On Samadhi Samadhi – Absorb Yama & Niyama 1. Ahimsa – Non violence 2. Satya – Truthfulness 3. Asteya – Non stealing 4. Brahmacarya – Continence 5. Ksama – Forgiving 6. Dhrti – Endurance 7. Daya – Compassion 8. Arjavam – Straight forwardness 9. Mitahara – Sparing diet 10. Saucam – Cleanliness Niyamas 1. Tapas – Penance 2. Santosa – Contentment 3. Sravana – Hearing the scriptures 4. Isvara pujanam – Worship of god 5. Astikyam – Belief in god 6. Danam – Charity 7. Hrih – Modesty 8. Matih – Analysis 9. Hutam – Yajna 10. Tapah – Offering #Online Best yoga certification courses in Bangalore CHAPTER – 1 Asanas (67 Verses) Yogi Swatamaram instructs that Hatha Yoga is only for the highest stage of Yoga Astha Sidhis • Anima – The ability to become very small • Laghima – The ability to become very light or weightless • Mahima – The ability to become as large as possible • Garima – The ability to become heavy • Prapti – The ability to reach any place • Prakamya – The ability to stay under the water and to maintain the body Youthful. • Vasitva – The ability to control over all objects, Organic and inorganic • Isitva – The ability to create and destroy at will Preparations Place of Practice, the Hatha Yogi should live alone in a heritage and practice in a place where there is no hazard from rocks, fire, or water and which is in a well administered and virtuous kingdom (nation or town) where good alms can be easily attained. There are six causes of failure in Sadhna • Over eating • Exertion • Talkativeness • Adhering to rules • Company of Common people • Unsteadiness. Asana is the first part of Hatha Yoga Asana or specific body position opens the energy channels and psychic centers. The Hatha Yogis found that by developing control of the body through asana the mind is controlled. According to Hatha Ratnavali Lord Shiva taught 84 asanas, taking the examples of 84, 00,000 creations. Ghraksha Satarka says – every one of the 8, 40,000 asanas had been told by Lord Shiva. Out of them 84 postures have been selected of all the Haöha Yoga exist, Gheranda Samhita described 32 asanas and Hatha Ratnavali names the 84 asanas. Asanas presented in Hatha Yoga Pradipika. • Swasthikasana

May 30, 2017 No Comments

GHERANDA SAMHITA

GHERANDA SAMHITA Gheranda Samhita is a systematically written text on yoga. It is in the form of a dialogue between Gheranda the preceptor and Chandkapali the (pupil). The yoga that has been discussed in Gheranda Samhita is called Ghathasta Yoga. “Gatha” refers to the body. Ghathasta Yoga means Yoga based approach through the body and the training of the body is the first step to the training of the mind. Obviously Ghathastha Yoga or Ghathastha Yoga deals with the Hatha Yoga practices. It describes more than 100 Yogic practices of varied nature. These practices can be classified as follows: Kriyas – 06 Dhautis – 13 Bastis – 12 Neti – 01 Lauli – 01 Kapalabhati – 03 Trataka – 01 Asanas – 32 Mudras – 25 Pratyahara – 5 Pranayama – 10 Dhyana – 3 Samadhi – 6 Total 102 In these Yogic practices there is gradual evolution of the process from Physical to Spiritual through Psychological process. Gheranda Samhita explains all the above practices in seven lessons. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – 1 On the training of the physical body The training of the body is the first step to the training of the mind. A healthy mind can exist only in a healthy body. Hence the Hatha Yoga or training of the body is the first step to the training of the mind or Raja yoga. Lesson first start with the question of Chandkapali who wishes to know the physical discipline (Yoga) leads to the knowledge of truth (Tattava Jnana). Gheranda explains there is no fetters like those of illusion (maya) no strength like that which comes from discipline (Yoga). There is no friend higher than knowledge (Jnana) and no greater enemy than egoism (Ahankara). As by learning the alphabets, through practice one can master all the sciences, so by thoroughly practicing, first the (physical) training, one requires the knowledge of the truth. By practice of yoga one can overcome maya. There are seven exercises which pertain to the training of the body. They are particularly strengthening, steadying, calming and those leading of lightness, perception and isolation. The satkarmas are the six processes which include Dhauti, Basti, Neti, Laukiki, Trataka and kapalabhati. The technique and importance of these are also given in details. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore The sapta Sadhanas are, Kriyas – For cleansing Asanas – Gives Dridhata or strength Mudras – Gives Sithirata or Steadiness Pratyahara – Gives Dhairya or calmness Pranayama – Gives lightness or Laghima Dhyana – Gives perception or pratyakshatwa Samadhi – Gives Isolation, nirtipta which is the freedom #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER -II Asanas and Postures There are 84, 00,000 asanas described by Lord Shiva, The postures are as many in the numbers of species of living creature in the universe. Among them 84 are the best and among these 32 have been found useful for mankind in this world. Sidhasana – Perfect Padmasana – Lotus Bhadrasana – Gentle Muktasana – Free Vajrasana – Adamant Swastikasana – Prosperous Simhasana – Lion Gomukhasanan – Cow – mouth Veerasana – Heroic Dhanurasana – Bow Maritasana – Crops Guptasana – Hidden Matsyasana – Fish Matsyendasana – Sage Gorakasana – Sage Paschimotanasana – Fish Utkatasana – Hazardous Sankatasana – Dangerous Mayurasana – Peacock Kukkutasana – Cock Kurmasana – Tortoise Uttanamandukasana – Frog Uttanakurmasana – Tortoise Vrikshasana – Tree Mandukasana – Frog Garndasana – Eagle Vrishasana – Bull slabhasana – Locust Makarasana – Crocodile Ustrasana – Camel Bhujangasana – Snake #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore The very first asana – namely siddhasana is described as mokkna-kavatabhedanka (which opens the doors of realization, Padmasana, Bhadrasana, Simhasana, Matsyasana, all these destroy all sorts of disease). Muktasana gives siddhis (perfection) Vajrasana gives psychic powers to the yogi. Mritasana destroy fatigue and quiten the agitations of the mind. Gorakasana gives success to the yogis; Mayurasana destroys the effect of whole some food. It produces heat in the stomach; it destroys the effect of deadly poisons. If easily cures diseases like fever etc. Makarasana increases the body heat, Bhujangasana (serpent) always increases the bodily heat, destroys all diseases and by the practice of this posture the Kundalini force is awakened. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – III Mudras There are 25 Mudras the practice of which gives senses to the yogis, they are. Mahamudra Nabho Uddiyana Jalandhara Mulabandha Maha Bandha Maha Bheda Khecari Viparita Karani Vajroli Sakticalana Tadagi Mandauki Sambhavi 20 Panca Dharma (Five Dharma) Asvini Pasini Kaki Matangini Bhujanginini These Mudras which gives happiness and emancipation. These Mudras destroys all diseases. There is nothing in the world like the Mudras for giving quick success. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – IV Prathyahara By prathyahara all the passions like lust are destroyed. Let one bring the chitta (thinking principle) under his control by withdrawing it wherever it wanders away driven by the various objects of right, praise or censer good or bad, speech, sweet or bad, smell or taste or what ever the mind may be distracted or attracted. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER -V Pranayama Four things are necessary for practicing Pranayama in Good place. Suitable time Moderate food. Purification of the Nadis The purification of the Nadis is of two sorts. Samanu and Nirmanu. The Samanu is done by a mental process with Bijamantra. The Nirmanu is performed by physical cleanings. After purification of the Nadis one has to sit firmly in a posture and be in regular Pranayama. #50/100/200/300/500 hr Yoga teacher

May 30, 2017 No Comments

Patanjali Yoga Sutra – Vibhuti Pada: Samyama and psychic powers

Patanjali Yoga Sutra – Vibhuti Pada: Samyama and psychic powers By samyama knowledge of past & future 3.16. Parinamatrayasamymadatitanagatajnanam| Parinama-transformation Traya-three Samymat-by samyama Atita-past Anagatah-future Jnanam-knowledge By practicing samyama on the three transformations, knowledge of past and future thing arise. By samyama knowledge of all speech 3.17. Sabdarthapratyayanamitaretaradhyasat saìkarastat pravibhagasamyamat sarvabhutarutajnanam| Sabda-word Artha-object Pratyayanam-mental content Itaretaradhyasat-because of mental superimposition Sankara-confusion Tat-that Pravibhaga-separate Samyamat-by samyama Sarvabhuta-all living beings Ruta-speech Jnanam-knowledge#Yoga course Bangalore The word, object and mental content are in a confused condition because of mutual superimposition. By practicing smyama on them separately, knowledge of the speech of all beings arises. By samyama knowledge of previous birth 3.18. Samskarasaksatkaranat purvajatijnanam| Samskara-impression Saksatkaranat-by direct impression Purva-previous Jati-birth Jnanam-knowledge By direct perception of the impressions, knowledge of previous births comes. By samyama knowledge of other’s mind 3.19. Pratyayasya parachittajnanam| Pratyayasya-of the content of the mind Para-another Chitta-mind Jnanam-knowledge By practicing samyama on the pratyayas, knowledge of others mind known. But not mental image 3.20. Na tat salambanam tasyavisayibhutatvat| Na-not Tat-that Salambanam-with support Tasya-its Avisayibhutatvat-because of not being the subject of samyama But the knowledge of other mental factors is not gained with support of the mental image because that is not the object of samyama. #Yoga course Bangalore By samyama power of invisibility 3.21. Kayarupasamyamat tatgrahyasaktistambhe chaksuhprakasasamprayoge’ntardhanam| Kaya-body Rupa-form Samyamat-by doing samyama Tat-that Grahya-receptive Sakti-power Stambhe-on suspension ChakSuh-the eye Prakasa-light Samprayoga-absence of contact Antardhanam-being invisible By applying samyama on the form of the body and suspended receptivity of the form, there being no contact between the eye and the light, the yogi can become invisible. By samyama power of disappearance 3.22. Etena sabdadyantardhanamuktam| Etena-by this Sabdadi-sound and others Antardhanam-disaapearance Uktam-said By what has been said the vanish of sound and other tanmatras can be understood. #Yoga course Bangalore By samyama knowledge of time of death 3.23.Sopakramamnirupakramam cha karma tatsamyamadaparantajnanamapyaristebhyo va| Sopakramam-the karma which activity Nirupakramam-the karma that is dormant Cha-and Karma-action Tat-that Samyamad-by performing samyama Aparanta-death Jnanam-knowledge Aristebhyah-by omens Va-or Karma is of two types, active and dormant. By applying samyama on them knowledge of death is gained, also by omens. By samyama power of friendliness 3.24. Maitryadisu balani| Maitri-frienliness Adisu-etc Balani-powers By applying samyama on friendliness, etc. there come those particular powers friendliness. By samyama attainment of strength 3.25. Balesu hastibaladini| Balesu-by samyama on the powers Hasti-elephant Bala-stength Adini-etc By applying samyama on the stenght of an elephant, etc. the corresponding strength is gained. By samyama gain hidden knowledge 3.26. Pravrttyalokanyasat suksmavyavahitaviprakrstarsva jnanam| Pravrtti-super physical faculty Aloka-like Nyasat-by projecting Suksma-fine Vyavahita-hidden Viprakrsta-distant Jnanam-knowledge The knowledge of subtle, obscure or distant objects is profited by dilating the light of the superphysical faculty. By samyama knowledge of the solar system 3.27. Bhuvanajnanam suryasamyamat| Bhuvana-solar system Jnanam-knowledge Surye-on the sun Samyamat-by performinf samyama Knowledge of the solar system is gained by applying samyama on the sun. By samyama knowledge of the stars 3.28. Candre taravyuhajnanam| Candre-moon Tara-stars Vyuha-arrangements Jnanam-knowledge By applying samyama on the moon, knowledge about the position of the stars is benefited. #Yoga course Bangalore By samyama knowledge of star movements 3.29. Dhruve tadgatijnanam| Dhruve-by performing samyama on the pole star Tat-that Gati-movement Jnanam-knowledge By applying samyama on the pole star, knowledge of the movement of the stars can be acquired. #Yoga course Bangalore By samyama knowledge of the body 3.30. Nabhichakre kayavyuhajnanam| Nabhi-navel Chakre-centre Kaya-body Vyuha-arrangement Jnanam-knowledge By applying samyama on the navel centre, knowledge of the arrangements in the body is obtained. By samyama mastery over hunger & thirst 3.31. Kanthakupe ksutpipasa nivrttih| Kanthakupe-by performing samyama on the throat Ksut-hunger Pipasa-thirst Nivrttih-retirement By applying samyama on the throat pit, hunger and thirst would not happen. 3.32. Kurmanadyam sthairyam| Kurmanadyam-by performing samyama on the kurma nadi Sthairyam-staediness Stableness is gained by applying samyama on the kurma nadi. #Yoga course Bangalore By samyama gain spiritual vision 3.33. Murdhajyotisi siddhadarsanam| Murdha-crown of the head Jyotisi-on the light Siddha-adept Darsanam-spiritual vision By applying smayama on the light of the crown of the head at sahasrara cakra, a spiritual vision of the masters of yoga is obtained. By samyama acquire intuitive knowledge 3.34. Pratibhadva sarvam| Pratibhat-from pratibha Va-or Sarvam-everything Or everything by virtue os pratibha or intuition. By samyama gain awareness of consciouness 3.35. Hradaye chittasamvit| Hradaye-by performing smayama on the heart Chittasamvit-awareness of the consciousness By applying samyama on the heart, awareness of consciouness dawns. #Yoga course Bangalore By samyama knowledge of universal consciousness 3.36. Sattva purusayoratyantasanké rnayoh pratyayaviseso bhogah pararthatvat svarthasamyamat purusa jnanam| Sattva-chitta Purusayoh-of the purusha Atyanta-extremely Asankirnayoh-distinct Pratyaya-awareness Avisesah-not distinct Bhogah-experience Pararthatvat-from objective consciousness Sva-ones own Artha-subjective awareness Samyamat-by samyama Purusajnanam-knowledge of purusha Chitta and purusha are extremly different. On account of non-difference of the awareness of both there is objective or subjective experience. By applying samyama on subjective awareness apart from objectives awareness, the knowledge of purusha is acquired. By samyama gain power of intuitive perception 3.37. Tatah pratibhasravanavedanadarsasvadavartta jayante, Tatah-therefrom Pratibha-the faculty of superior consciousness Sravana-the faculty of hearing Vedana-touch consciousness Darsa-visulization Asvada-faculty of taste Vartta-the olfactory faculty Jayante-are produced By applying samyama gain power of intuitive perception, therefrom are produced transcendental audition, sensation, perception, taste and olfactory knowledge. #Yoga course Bangalore

May 30, 2017 No Comments

Patanjali Yoga Sutra – Vibhuti Pada – Psychic powers are obstacles in path of Yoga

Patanjali Yoga Sutra – Vibhuti Pada – Psychic powers are obstacles in path of Yoga 3.38. Te samadhvupasarga vyutthane siddhayah| Te-they Samadhau-in samadhi Upasarga-obstacles Vyuttane-in the state of the consciousness of the world Siddhayah-psychics powers These psychic powers or siddhis are hindrances in path of samadhi, but in the state of consciousness of the world they are psychic powers. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of entering another’s body 3.39. Bandhakaranasaithilyat pracarasamvedanachcha chittasya parasarirapravesah| Bandha-bondage Karana-cause Saithilyat-by loosening Prachara-passage Samvedanat-by knowledge Cha-and Chittasya-of the subtle body Para-of others Sarira-body Avesah-entry By releasing of the cause of bondage and by knowledge of the passage, the subtle body enters another person’s body. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of levitation 3.40. Udanajayajjalapankakantakadisvasanga utkrantischa| Udana-one of the five pranas Jayat-by mastery Jala-water Panka-mud Kantakadisu-with thorns etc. Asanga-no contact Utkrantih-levitation Cha-and By samyama on udana upa prana there is non-contact with water, mud, thorns etc. and the body gets levitated. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain Aura 3.41. Samanajayajjvalanam| Samana-the samana vayu Jayat-by mastery Jvalanam-blaze By applying samyama on the samana vayu, the body blazes. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of divine hearing 3.42. Srotrakasayoh sambandhasaàyamaddivyam srotram| Srotra-ear Akasayoh-space Sambandha-relation Samyamat-by samyama Divyam-divine Srotram-organ of hearing By applying samyama on the relation of the ear and space, gained divine hearing. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain faculty of moving through space 3.43. Kayakasayoh sambandhasamyamallaghutulasamapatteschakasagamanam| Kaya-body Akasayoh-of space Sambandha-relation Samyamat-by samyama Laghu-light Tula-cotton, wool Samapatteh-by fusion of mind Cha-and Akasa-space Gamanam-going through By applying samyama on the relation of body and space and by joining the mind wit the lightness of cotton, there is going through space. #200 hour Yoga teacher training certificate course in Bangalore Gain universal state of mind 3.44. Bahirakalpita vrttirmahavideha tatah prakasavaranaksayah| Bahih-external Akalpita-unimaginable Vrttih-state of mind Mahavideha-existence wihout body Tatah-therefrom Prakasa-light Avarana-covering Ksayah-distraction In the state of, existence without body, the vrittis are inconceivable and outside the scope of the body, whereby the covering of light is destroyed. #200 hour Yoga teacher training certificate course in Bangalore By samyama mastery over twenty five tattvas or bhutas 3.45.Sthulasvarupasuksmanvayarthavattvasamyamadbhutajayah| Sthula-gross Svarupa-real form Suksma-subtle Anvaya-interpenetrating Arthavattva-serving the purpose Samyamad-by samyama Bhutajayah-mastery over elements By performing samayama on the gross, basic, subtle and interpenetrating states and the purpose of the bhutas, mastery over them is gained. #200 hour Yoga teacher training certificate course in Bangalore By samyama attainment of eight psychic powers(asta siddhis) 3.46.Tato’nimadipradurbhavah kayasampattaddharmanabhighatascha| Tatah-therefrom Animadi-anima etc. Pradurbhavah-appearance Kayasampat-bodily well Tat-that Dharma-function Anabhighatah-non-obstructions Cha-and From that the appearance of anima, perfection of the body and non-obstruction from the functions of the body gained. #200 hour Yoga teacher training certificate course in Bangalore Perfection of the physical body 3.47. Rupalavanyabalavajrasamhananatvani kayasampat| Rupa-form, beauty Lavanya-grace Bala-stength Vajrasamhananatvani- hardness Kaya-physical Sampat-wealth The perfection of the physical body includes beauty, grace, energy, and hardness. #200 hour Yoga teacher training certificate course in Bangalore By samyama mastery of sense organs 3.48. Grahanasvarupasmitanvayasamyamadindriyajayah| Grahana-power of cognition Svarupa-real nature Asmita-egoism Anvayarthavatva samyamat-by samyama Indriyajayah-mastery over the sense organs Mastery over the sense organs is obtained by applying samyama on the power of cognition, real nature, egoism, all-pervasiveness and purposefulness. #200 hour Yoga teacher training certificate course in Bangalore Mastery over prakriti 3.49. Tato manojavitvam vikaranabhavah pradhanajayascha| Tatah-therefrom Manojavitvam-speed of mind Vikaranabhavah-freedom from sense organs Pradhanajayah-conquest of prakriti Cha-and Therefrom follows speed like that of mind, independent from any medium of instrumentality and mastery of the limitations of prakriti. #200 hour Yoga teacher training certificate course in Bangalore By samyama power of omnipotence & omniscience 3.50. Sattvapurushanyatakhyatimatrasya sarvabhavadhisthatrtvam sarvajnatrtvam cha| Sattva-chitta Purusha-self Anyata-difference Khyati-awareness Matrasya-only Sarva-all Bhava-states of existence Adhisthatrtvam-supermacy Sarvajnatrtvam-omniscience Cha-and Just by knowledge of the awareness of the difference between chitta and purusha follows supermacy over all states and forms of existence and omniscience. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain detachment and knowledge 3.51. Tadvairagyadapi dosabijaksaye kaivalyam| Tat-that Vairagyat-by vairagya Api-even Dosa-defect Bija-seed Ksaye-due to destruction Kaivalyam-isolation By detachment, even regarding the powers, the seed of defect is eliminated and kaivalya is reached. #200 hour Yoga teacher training certificate course in Bangalore Causes of downfall in spiritual path 3.52. Sthanyupanimantrane sangasmayakaranam punanistaprasangat| Sthani-gods Upanimantrane-on being respectfully Sanga-attachment Smaya-pride Akaranam-by not Punah-once again Anista-undesirable Prasangat-by revival On being invited by the gods there should be no attachment and pride, because of the possibility of revival of the undesirable. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain awareness of ultimate reality 3.53. Ksana tatkramayo samyamdvivekajam jnanam| Ksana-moment Tatkramayoh-its order of succession Samyamat-by samyama Vivekjam-born of realization Jnanam-knowledge By applying samyama on moment and its order of succession is born the knowledge of realization of the ultimate reality. By samyama knowledge of distinctions 3.54. Jatialaksana desairanyatanavachchhedat tulyayostatah pratipattih| Jati-birth Laksana-charaterictic Desayoh-by place Anyata-difference Anavachchhedat-on account of no definiton Tulyayoh-of the two similar objects Tatah-therefrom Pratipattih-knowledge By samyama transcendental knowledge 3.55. Tarakam sarvavisayam sarvatha visayamakramam cheti vivekajam jnanam| Tarakam-transcendental Sarvavisayam-all subjects sarvatha visayam-object of every place akramam-beyond the order of successon cha-and iti-that is all vivekajam jnanam- knowledge born of viveka Transcendental knowledge includes the knowledge of all objects beyond all orders of succession and is born of discrimination. Attainment of kaivalya 3.56. Sattvapurusayoh suddhisamye kaivalyamiti| Sattva-chitta Purusayoh-of the purusha Suddhi-purification Samye-on becoming equal Kaivalyam-isolation Iti-end Kaivalya is attained by equalizing and cleansing the illumination of purusha and chitta.

May 30, 2017 No Comments

Patanjali Yoga Sutra-Vibhuti Pada – What is Concentration?

Patanjali Yoga Sutra – Vibhuti Pada – What is Concentration? 3.1 Desabandhaschittasya dharana | #Yoga teacher training certificate course fees in Bangalore Desa-place Bandha-binding Chittasya-of the mind Dharana-concentration Cocentration is bringing the mind to one place with effort. #Yoga teacher training certificate course fees in Bangalore Patanjali Yoga Sutra – Vibhuti Pada What is Meditation? 3.2. Tatra pratyayaikatanata dhyanam| Tatra-there(in the desha) Pratyaya-basis or content of consciousness Ekatanata-continuity Dhyanam-meditation Uninterrupted stream of the content of consciouness is Meditation. #Yoga teacher training certificate course fees in Bangalore Patanjali Yoga Sutra – Vibhuti Pada What is Samadhi or superconsciousness? 3.3.Tadevarthamatranirbhasaà svarupasunyamiva samadhih| Tadeva-the same Artha-the object of dhayana Matra-only Nirbhasam-appearing Svarüpa-one own form Sunyam-empty Iva-as if Samadhih-trance Samadhi is called, when there is only the object appearing without the consciousness of ones own self.

May 30, 2017 No Comments

Patanjali Yoga Sutra – Sadhana Pada – Eight limbs of Yoga

Patanjali Yoga Sutra – Sadhana Pada – Eight limbs of Yoga 2.29.Yamaniyamasanapranayamaprtayaharadharanadhyanasamadhayo’stavangani| Yama-self restraints Niyama-fixed rules Asana-postures Pranayama-breath control Pratayahara-sense withdrawl Dharana-concentration Dhyana-meditation Samadhai-samadhi Asta-eight Angani-parts Personal ethics, social ethics, postures, breath control practice, sense withdrawl from its sense objects, concentration, meditation and samadhi or supersonsciouness, constitute the eight limbs of yoga discipline. Five Self-Discipline 2.30. AhimsaSatyaAsteyaBrahmacharyaaparigraha Yamah| Ahimsa- Non-violence Satya- truthfullness Asteya- honesty Brahmacarya-sensual abstinence Aparigraha-non-acquistiveness Yamah-self-restraints Non-violence, truth, honesty, sensual abstinence, and non-possesiveness are the five self-disciplines. Following Self-Discipline is the great Path 2.31. Jatidesakalasamayanavacchinnah sarvabhauma mahavratam| Jati-class of birth Desa-country, or place Kala-time Samaya-circumstances Anavacchinnah-unconditioned Sarvabhauma-universal Mahavratam-the great discipline It can be practiced universally without exception due to birth, place, time and circumstances then yamas become great disciplines. Social-discipline for yoga practice 2.32. Sauchasantosatapahsvadhyayesvarapranidhanani niyamah| Saucha-clenaliness Santosa-contentment Tapah-austerity Svadhyaya-self-study Isvara pranidhanani-resignation to god Niyamah-fixed rules Cleanliness, contentment, austerity, self-study and self-surrender to God constitute social discipline. Path to remove mind disturbance 33. Vitarkabadhane pratipaksabhavanam| Vitarka-passions Badhane- on disturbances Pratipaksa-the opposite Bhavanam-pondering over#Yoga teacher training certificate course fees in Bangalore When the mind is disturbed by passions one should practise contemplating over their opposites nature. Qualities and characteristics of mind disturbances 2.34. Vitarka himsadayah krtakaritanumodita lobhakrodhamohapurvaka mrdumadhyadimatraduhkhajnananantaphala iti pratipaksabhavanam| Vitarka-evil passions Himsadayah-violence and others Krta-done by ones self Karita-done through others Anumodita-approved Lobha-gree#Yoga teacher training certificate course fees in Bangalore Krodha-anger Moha-confusion Purvaka-preceded by mrdu-mild madhya-moderate adhimatra-intense duhkha-pain ajnana-ignorance ananta-infinite phalah-reults iti-like that pratipaksa-opposite bhavanam-thinking Thinking of evil thoughts such as violence, whether done through oneself, through others, or approved, is caused by greed, anger and confusion. They can be mild, medium, or intense. Pratipaksha bhavana is thinking that these evil thoughts cause infinite pain and ignorance. Benefits of following Non-Violenc #Yoga teacher training certificate course fees in Bangalore 2.35. Ahimsapratisthayam tatsamnidhau vairatyagah| Ahiàsa-non-violence Pratisthayam-on being firmly established Tatsamnidhau-in its vicinity Vaira-hostility Tyagah-abandonment Those who following strongly ahimsa path, there is abandonment of hostility and enmity in his vicinity. Benefits of following Truthfulness 2.36. Satyapratisthayam kriyaphalasrayatvam| Satya-truthfulness Pratisthayam-on being firmly established Kriya-action Phala-result or fruit Asrayatvam-basis Those who following truthfullness, the actions result in fruits, entirely depending on them. Benefits of being honesty 2.37. Asteyapratisthayam sarvaratnopasthanam| Asteya-honesty Pratisthayam-on being firmly established Sarva-all Ratna-gems Upasthanam-self-presentation By being firmly established in honesty path, so all gems present with themselves. Benefits of being celibacy 2.38. Brahmacharyapratisthayam viryalabhah| Brahmacharya-sexual abstinence Pratisthayam-on being firmly established Virya-indomitable courage Labhah-gain By following celibacy, veerya is gained. #Yoga teacher training certificate course fees in Bangalore Benefits of following Non-possessiveness 2.39. Aparigrahasthairye janmakathantssambodah| Aparigraha-non-possessiveness Sthairye-on becoming steady Janma-birth Kathanta-how and from where Sambodah-knowledge On becoming stable in non-possessiveness, there arises the knowledge of how and from where birth arise. Benefits of being cleanliness #Yoga teacher training certificate course fees in Bangalore 2.40. Saucat svanga jugupsa parairasaàsargah| Saucat-from clealiness Svanga-one own body Jugupsa-indifference Paraih-with others Asamsargah-non-attachment By being cleanliness there comes indifference towards one’s own body and non-attachment to others. Control of mind through cleanliness 2.41. Satvasuddhi saumanasyaikagryendriyajayatmadarsanayogyatvani cha| Satvasuddhi-purity of internal being Sauomanasya-cheer fullness Ekagrya-one-pointedness Indriyajaya-control of senses Atmadarsana-vision of the self Yogyatvani-ftness Cha-and By the practice of mental purity one gains qualification for cheerfulness, one-pointedness, sense control and vision of the self. Benefits of being contentment #Yoga teacher training certificate course fees in Bangalore 2.42. Santosadanuttamasukhalabhah| Santosad-from contentment Anuttamah-unexcelled Sukha-pleasure Labhah-gain Infinite happiness comes from the practice of contentment. Benefits of austerities 2.43. Kayendriya siddhirasuddhiksayattapasah| Kaya-the body Indriya-sense organ Siddhi-perfection Asuddhi-impurity Ksayat-destruction Tapasah-by austerities By following austerities, impurities are eradicated and there appears perfection in the body and sense organs. Benefits of self-study #Yoga teacher training certificate course fees in Bangalore 2.44. Svadhyayadistadevatasamprayogah| Svadhyayat-by self-awareness, self-obsrvation Istadevata-the deity of choice Samprayogah-communion By self-study, union with the desired deity is brought about. Benefits of self-surrendering to God 2.45. Samadhisiddhirisvarapranidhanat| Samadhi- superconsiousness Siddhi-perfection Isvara-god Pranidhanat-self-surrender Succcess in superconsiousness comes by complete resignation to God. How should be Asana? #Yoga teacher training certificate course fees in Bangalore 2.46. Sthirasukhamasanam| Sthira-steady Sukham-comfortable Asanam-posture Steady and comfortable should be the posture. How to mastery Asana 2.47. Prayatnasaithilyananatasamapattibhyam| Prayatna-effort Saithilya-looseness Ananta-the serpent called ananta Samapattibhyam-by meditation By effortless effort and by meditation on the serpent ananta, asana is mastered. Benefits of by mastery over Asana 2.48. Tato dvandvanabhighatah| Tatah-from that Dvandva-pair of opposites Anabhighatah-no impact Thereby the pairs of opposites stop to have any impact. What is pranayama? 2.49. Tasmin sati svasaprasvasayorgativichchhedah pranayamah| Tasmin-on that Sati-having been Svasaprasvasayah-inhalation, exhalation Gati-movement#Yoga teacher training certificate course fees in Bangalore Vichchhedah-break, cessation Pranayamah-pranayama After the asana practice done, pranayama is the stopping of the movement of incoming and outcomng breath. Types of Pranayama 2.50. Bahyabhyantarastambhavrttih desakalasankhyabhih paridrsto dirghasuksmah , Bahyah-outer Abhyantara-internal Stambhavrttih-supperessed stage Desa-place Kala-time Sankhyabhih-number Paridrstah-measured Dirgha-prolonged Suksmah-subtle Pranayama is external, internal #Yoga teacher training certificate course fees in Bangalore or suspended, regulated by place, time and number and becomes prolonged and subtle. Fourth type of pranayama 2.51. Bahyabhyantaravisayaksepi chaturthah| Bahya-external Abhyantara-internal Viñaya-object Aksepi-transcending Chaturtha-fourth The fourth pranayama is that which transcends the internal and external object, called it breathless state. By practicing pranayama luminosity achieved 2.52. Tatah ksiyate prakasavaranam| Tatah-thereby Ksiyate-disappears#Yoga teacher training certificate course fees in Bangalore Prakasa-light Avaranam-covering Thereby the covering of light vanish. Pranayama for good concentration 2.53. Dharanasu cha yogyata manasah| Dharanasu-in concentartion Cha-and Yogyata-fitness Manasah-of the mind And mind becomes well qualified for concentration. Withdrawing of the mind 2.54. Svavisayasamprayoge chittasvarupanukara indriyanam pratyaharah| Sva-ones own Visaya-object Asamprayoge-not coming into contact Chitta-mind Svarupa-own form Anukara-imitating Iva-as if Indriyanam-of the senses Pratyaharah-withdrawal Pratyahara means, the imitation by #Yoga teacher training certificate course fees in Bangalore the senses of the mind by withdrawing them from their respective sense objects. Mastery over the senses by pratyahara 2.55. Tatah paramavasyatendriyanam| Tatah-thereby Parama-highest Vasyate-mastery Indriyanam-of the senses This is the highest state of mastery over the sense organs by pratyahara practice. #Yoga teacher training certificate course fees in Bangalore

May 30, 2017 No Comments

Patanjali Yoga Sutra – Sadhana Pada- Reasons for experiencing pain & how to remove it?

Patanjali Yoga Sutra – Sadhana Pada- Reasons for experiencing pain & how to remove it? 2.3. Avidyasmitaragadvesabhinivesah klesah| Avidya-ignorance Asmita-i-feeling Raga-liking Dvesa-repulsion Abhinivesah-fear of death Klesah-afflictions Ignorance, I-feeling, liking, disliking and fear of death, this all are the reasons for experiencing pains in our walk of life . #Best yoga teacher training certification courses in Bangalore Ignorance is the foundation cause for all pain 2.4. Avidyaksetramuttaresam prasuptatanuvichchhinnodaranam| Avidya-avidya Ksetram-field Uttaresam-of the following Prasupta-dormant Tanu-thin Vichchhinna-scattered Udaranam-fully operated, expanded Avidya or ignorance can be resided in the states of dormant, thin, scattered or expanded. #Best yoga teacher training certification courses in Bangalore Meaning for Ignorance? 2.5. Anityasuchiduhkhanatmasu nityasuchisukhatmakhyatiravidya| Anitya-not eternal Asuchi-impure Duhkha-pain Anatmasu-non-atman Nitya-eternal Suchi-pure Sukha-happiness Atma-self Khyati-knowledge Avidya-ignorance Meaning of Avidya or Ignorance is mis-understanding of non-eternal, impure, evil things considering as eternal, pure, good and atman. Ego or ‘I’ feeling is one of the ignorance 2.6. Drgdarsanasaktyorekatmataivasmita| Drg-purusha, power of consciousness, power to see Darsana-that which is seen, cognition Saktyoh-of the two powers Ekatmata-identity Iva-as if Asmita-i-feeling Asmita or ‘I’feeling, is the identity as it were of the purusha or pure consciousness with the Buddhi or discrminated knowledge. #Best yoga teacher training certification courses in Bangalore Attachment is the one of the Ignorance 2.7. Sukhanusayi ragah| Sukha-pleasure Anusayi-accompanying Ragah-liking Raga is the liking to such activities, which gives all sensual pleasures. Hatred is one of the Ignorance 2.8. Duhkhanusayi dvesah| Duhkha-pain Anusayi-accompanying Dvesah-repulsion Disliking means, the action which gives pain to physicall and mental level. #Best yoga teacher training certification courses in Bangalore Clinging to life is one of the ignorance 2.9. Svarasavahi viduso’pi tatharudho’bhinivesah| Svarasavahi-sustained by its one force Vidush-of the learned Api-even Tatha-like that Rudhah-dominating Abhinivesah-fear of death, clining to life Abhinivesha means desire for mundane life to extend, even this quality dominates learned wise people too. #Best yoga teacher training certification courses in Bangalore Future Pain in life can be reducible 2.10. Te pratiprasavaheyah suksmah| Te-they Pratiprasavah-involution Heyah-reducible Suksmah-subtle Those future pains can be avoidable or reducible by involution or by yogic practice, when they are subtle. #Best yoga teacher training certification courses in Bangalore Through Meditation Future Pain can Be Avoidable 11. Dhyanaheyastadvrttayah| Dhyana-meditation Heyah-reducible Tadvrttayah-their modification The modifications of the kleshas are reducible through meditation. #Best yoga teacher training certification courses in Bangalore Our past accumulated action is reason for present & future pain 2.12. Klesamulah karmasayo drsthadrsthajanmavedaniyah| Klesa-affliction Mulah-root Karma-action Asayo-reservoir Drstha-seen, present Adrstha-not seen, future Janma-birth Vedaniyah-to be experienced This accumulated karmas which is the root cause of afflictions is to be experienced in the present and future births. Fruits of accumulated action 2.13. Sati mule tadvipako jatyayurbhogah| Sati mule- so long as the root is there Tat-it Vipakah-ripening Jati-birth, class Ayuh-span of life Bhogah-experience So long as the root of accumulated karma is there, it ripens and gives birth and class, span of life and experience. #Best yoga teacher training certification courses in Bangalore Fruits depend on past life action 2.14. Te hladaparitapaphalah punyapunyahetutvat| Te-they Hlada-joy Paritapa-sorrow Phalah-fruits Punya-merit Apunya-demerit Hetutvat-on account of They have happiness or sorrow as their fruits depending upon their merit or demerit of past life action. #Best yoga teacher training certification courses in Bangalore Pleasure and pain both are painful indeed 2.15. Parinamatapasamskaraduhkhairgunavrttivirodhacca duhkhamva sarvam vivekinah , Parinama-result, consequence Tapa-acute suffering Samskara-impression Duhkhaih-by these three pains Guna-three gunas Vrtti-modification of mind Virodhat-on account of, opposing Cha-and Duhkham-pain Eva-only Sarvam-all Vivekinah-those who have discrimination In the case of one who has discrimintaive knowledge (viveka), all is painful because of pains due to change, acute suffering, samskaras, and also due to gunas and vrittis in opposition. #Best yoga teacher training certification courses in Bangalore

May 30, 2017 No Comments

Patanjali Yoga Sutra – Sadhana Pada- Why should follow Discipline?

Patanjali Yoga Sutra – Sadhana Pada- Why should follow Discipline? Major Discipline for Yoga Practice 2.1. Tapahsvadhyayayesvarapranidhanani kriyaayogah| Tapah- austerity Svadhyaya-self-study of scriptures Ishvarapranidhana-surrender to god Kriya yoga-practical yoga Tapas, Swadhyaya and ishwara pranidhana is caled kriya yoga. Why should one pursue discipline for Yoga Practice 2.2. Samadhibhavanarthah klesatanukaranarthasca| Samadhi-superconsciousness Bhavanarthah-for developing the state of Klesa-cause of afflictions Tanu-thin Karanartha- for making Cha-and For growing the consciousness of samadhi and for the aim of thinning out the cause of afflictions, so that kriya yoga practised. #100/200/300/500 hour Yoga teacher training India

May 30, 2017 No Comments

Hatha Yoga Pradipika – Chapter Four: Samadhi

Hatha Yoga Pradipika – Chapter Four: Samadhi Synonymous words for Raja Yoga Rajayogah samadhis cha unmani cha manonmani / Amaratvam layas tattvam sunyasunyam param padam// Raja Yoga, Samadhi, Unmani, Manonmani, Amaratva, Laya, Sahaja Tattva, Shoonyashoonya, Parampadam. (Chapter -4, Verse 3). #100/200/300/500 hour Yoga teacher training India Amanaskam tathadvaitam niralambam niranjanam/ Jivanmuktischa sahaja turya chetyekavachakah// Amanaskam, advaitam, niralambha, niranjana, jivanmukti, sahaja and turiya are all synonymous words. (Chapter -4, Verse 4). #100/200/300/500 hour Yoga teacher training India Mind and Soul mixed like salt in the sea Salile saindhavam yadvatsamyam bhajati yogatah/ Tathatmamanasoraikyam samadhirabhidhiyate// As salt mixed in the sea, like that the mind and soul or atma are considered united in samadhi state. (Chapter -4, Verse 5). Ending of Prana and Mind in Samadhi state Ending of Prana and Mind in Samadhi state – Activities of prana is annihilated, then mind is reabsorbed in samadhi. Yada samkshiyate prano manasam cha praliyate/ Tada samarasatvam cha samadhir abhidhiyate// When the activities of Prana are totally annihilated, then mind is reabsorbed in samadhi state achieved. (Chapter -4, Verse 6). Individual soul merge with universal soul, all desires eliminated When Jivatma unites with Paramatma, desires are eliminated Tatsamam cha dvayoraikyam jivatmaparamatmanoh / Pranashtasarvasangkalpah samadhih so abhidhiyate// When the twofold characteristics of the individual soul and cosmic soul become one, all desires are eliminated and that state is called samadhi. (Chapter -4, Verse 7) #100/200/300/500 hour Yoga teacher training India Karmas get annihilated when prana flows in Sushumna Nadi All Karmas(actions) get annihilated when prana flows in sushumna nadi, mind remain in complete shoonya(void). Sushumnavahini prane sunye visati manase/ Tada sarvani karmani nirmulayati yogavit// When prana is moving through sushumna nadi, mind is in pure shoonya(void). Then all the karmas of the one knowing yoga are annihilated. (Chapter -4, Verse 12) #100/200/300/500 hour Yoga teacher training India Kundalini is to be blocked at Brahmarandhra Nadi The ultimate union and samadhi happens at sahasrara chakra. This location is at the crown of the head. The very upper portion of head is called brahmarandhra. The energy and consciousness must remain there, if they gone beyond, there is no return back to the physical body. Jnatva sushumnasadbhedam krtva vayum cha madhyagham / Sthitva sadaiva susthane brahmarandhre nirodhayet// Staying in the most conducive place, having found out how to penetrate sushumna and move the prana through the middle passage, it should be blocked in the brahmarandhra, the center of higher consciousness state.(Chapter -4, Verse 16). Manonmani (consciousness without mind) State Manonmani (consciousness without mind) – Manonmani is obtained when prana flows in sushumna nadi Sushumnavahini prane siddhyatyeva manonmani/ Anyatha tvitarabhyasah prayasayaiva yoghinam// When the prana travels in the sushumna nadi this state of manonmani (consciousness without mind) is obtained. Therefore, other forced practices are just laborious to the Hatha Yogi. (Chapter -4, Verse 20). #100/200/300/500 hour Yoga teacher training India Prana and mind are controlled through each other Pavano badhyate yena manastenaiva badhyate / Manascha badhyate yena pavanastena badhyate// Through controlling the prana, thought is contolled and through control of thought, prana or air is controlled. (Chapter -4, Verse 21). #100/200/300/500 hour Yoga teacher training India Chitta has two qualities: vasana and prana Hetudvayam tu chittasya vasana cha samiranah / Tayorvinashta ekasmintau dvavapi vinasyatah// Chitta has two qualities, vasana and prana. When one of the two is eliminated or deactivated the other also will become inertia. (Chapter -4, Verse 22). Stillness and interconnection between mind and prana Mano yatra viliyeta pavanastatra liyate/ Pavano liyate yatra manastatra viliyate// Where mind is stilled, then the prana is suspended there, and where prana is suspended, there the mind also gets stilled. (Chapter -4, Verse 23). Prana and Mind are united like milk and water #100/200/300/500 hour Yoga teacher training India Dughdhambuvatsammilitavubhau/ tau Tulyakriyau manasamarutau hi/ Yato maruttatra manahpravrttir // Yato manas tatra marutpravrttih// Mind and prana are united like milk and water. Two of them are equal in their activities. Where there is pranic movement or there mind also active. Where there is mind, there is prana too exist. (Chapter -4, Verse 24). Tatraikanasad aparasya nasa Ekapravrtter aparapravrttih / Adhvas tayos chendriyavarghavrttih Pradhvastayor mokshapadasya siddhih// Therefore, if one is destroyed, the other is annihilated; if one is active, the other becomes active, and while they exist, all the senses are active. If they are controlled, the state of liberation is obtained. (Chapter -4, Verse 25). Mind controlles the senses, prana controlles the mind, nada controlles the prana Indriyanam mano natho manonathastu marutah/ Marutasya layo nathah sa layo nadamasritah// Mind is the controller of the senses, prana is the controller of the mind. Dissolution is the lord of the prana and that dissolution, laya is the foundation of nada. (Chapter -4, Verse 29). Shambhavi Mudra (eyebrow center gazing) Shambhavi mudra (eyebrow center gazing) internalizes pranic flow and mind – If the Hatha Yogi remains with the chitta and prana absorbed in the internal object and gaze motionless, though seeing, he is not seeing, this is called shambhavi mudra, realm of Shiva consciousness). Antarlakshyam bahirdrshtir nimeshonmeshavarjita / Esha sa sambhavi mudra vedasastreshu ghopita// With internalised one-pointed awareness and external gaze unblinking, that truly is shambhavi mudra, preserved in the Vedas. (Chapter -4, Verse 36). Antarlakshyavilinachittapavano Yogi Yada vartate / Drshtya nischalataraya bahir adhah pasyannapasyannapi / Mudreyam khalu sambhavi bhavati sa labdha prasadad ghuroh/ Śunyasunyavilakshanam sphurati tattattvam Padam sambhavam// If the Hatha Yogi remains with the chitta and prana absorbed in the internal object and gaze motionless, though seeing, he is not seeing, this is called shambhavi mudra. When it is bestowed by the guru’s blessing, the state of shoonyashoonya obtained. That is the real state of Shiva consciousness. (Chapter -4, Verse 37) The Unmani Tare jyotishi samyojya kimchidunnamayed bhruvau/ Purvayogam mano yunjannunmanikarakah kshanat// Fix the gaze on the tip of the nose and raise the eyebrows a little, within the mind contemplating, inwardly thinking of Brahma, but apparently looking outside. This will create the Unmani avastha state. Bhrumadhya is the place of Shiva and place of turiya Bhrumadhya is the place of Shiva and place of turiya – Middle of the

May 30, 2017 No Comments

Hatha Yoga Pradipika – Chapter Three: Mudra and Bandha

Hatha Yoga Pradipika – Mudra and Bandha -Ten Mudras destroy old age Mahamudra mahabandho mahavedhascha khechari/ Uddiyanam mulabandhas cha bandho jalandharabhidhah//(Chapter -3, Verse 6). Maha Mudra, Maha Bandha, Maha Vedha, Khechari, Uddiyana, Moola Bandha and Jalandhara Bandha. (Chapter -3, Verse 6). #100/200/300/500 hour Yoga teacher training India Karani viparitakhya vajroli saktichalanam/ Idam hi mudradasakam jaramarananasanam//(Chapter -3, Verse 7). Viparita Karani Mudra, Vajroli and Shakti Chalana, truly, these are the ten mudras which destroy old age and death. (Chapter -3, Verse 7). #100/200/300/500 hour Yoga teacher training India (1). Maha Mudra (The Great Attitude) Padamulena vamena yonim sampidya dakshinam/ Prasaritam padam krtva karabhyam dharayeddrdham//(Chapter -3, Verse 10). Press the left heel into the perineum or vagina, straighten the right leg, and with the hands, strongly take hold of the outstretched foot. (Chapter -3, Verse 10). #100/200/300/500 hour Yoga teacher training India Kanthe bandham samaropya dharayed vayum urdhvatah / Yatha dandahatah sarpo dandakarah prajayate//(Chapter -3, Verse 11). By locking the throat and holding the breath, the prana rises straight, just like a snake beaten with a stick becomes straight. (Chapter -3, Verse 11). Rjvibhuta tatha saktih kundali sahasa bhavet/ Tada sa maranavastha jayate dviputasraya//(Chapter -3, Verse 12). So the kundalini sakti becomes very straight at once. Then the ida and pingala nadi become lifeless as the sakti enters into the sushumna nadi. (Chapter -3, Verse 12). Tatah sanaih sanaireva rechayennaiva veghatah/ Mahamudram cha tenaiva vadanti vibudhottamāh//(Chapter -3, Verse 13). Then breathe out slowly and gradually, not quickly. Indeed this is explained as maha mudra by the great siddhas. (Chapter -3, Verse 13). (2).Maha Bandha (Great Lock) Parshnim vamasya padasya yonisthane niyojayet/ Vamorupari samsthapya dakshinam charanam tatha// Press the heel of the left foot in the perineum or vagina and place the right foot on the left thigh. (Chapter -3, Verse 19). #100/200/300/500 hour Yoga teacher training India Purayitva tato vayum hrdaye chubukam drdham/ Nishpidya yonimakunchya manomadhye niyojayet// Thus breathing in, bring the chin to the chest strenum bone, Jalandhara Bandha, constrict the perineal or cervical region as moola bandha and focus on the eyebrow center known as shambhavi mudra). (Chapter -3, Verse 20). Dharayitva yathasakti rechayedanilam sanaih / Savyangghe tu samabhyasya dakshangghe punarabhyaset// Having holding the breath as long as feeling comfortable, then breathe out slowly. Once completing the practice on the left side, practice again on the right side too.(Chapter -3, Verse 21). Matamatra tu keshamchitkanthabandham vivarjayet/ Rajadantasthajihvaya bandhah sasto bhavediti// Some of them think that the throat lock Jalandhara Bandha is unnecessary and it is sufficient to keep the tongue against the front teeth. (Chapter -3, Verse 22). #100/200/300/500 hour Yoga teacher training India Kalapasamahabandhavimochanavichakshanah/ Trivenisangghamam dhatte kedaram prapayenmanah// Maha bandha release one from the bonds of death, makes the three nadis join together in Ajna chakra and enables the mind to attain the sacred state of Shiva, Kedara. (Chapter -3, Verse 24). (3). Maha Vedha Mudra (Great Piercing Attitude) Atha mahavedhah Mahabandhasthito yogi krtva purakam ekadhih/ Vayunam ghatimavrtya nibhrtam kanthamudraya// The Hatha Yogi, in the position of Maha Bandha, should breath in, make the mind steady and hold the movement of prana by doing the throat lock. (Chapter -3, Verse 26). #100/200/300/500 hour Yoga teacher training India Samahastayugho bhumau sphichau sanadayechchanaih/ Putadvayam atikramya vayuh sphurati madhyaghah// Placing the palms of the hands on the ground, he should slowly beat the bumps gently on the ground. The prana then leaves the two nadis ida and pingala and enters into the middle channel sushumna nadi. (Chapter -3, Verse 27). Mahavedhoa yam abhyasan mahasiddhipradayakah/ Valipalitavepaghnah sevyate sadhakottamaih// This is maha vedha, and by practicing its benefited great perfections. Wrinkles, grey hair and the trembling of old age are avoidable, thus the best of practitioners devote themselves to it. (Chapter -3, Verse 29). Khecharya mudritam yena vivaram lambikordhvatah/ Na tasya ksharate binduh kaminyasleshitasya cha// Even when there is movement of the bindu and it enters the genitals, it is catched by closing the perineum and is taken upward direction. (Chapter -3, Verse 43). Sushiram jnanajanakam panchasrotah samanvitam/ Tishthate khechari mudra tasminsunye niranjane// Five nadis unite in this cavity and it is the root source of knowledge. Khechari should be established in that void, untainted by ignorance. (Chapter -3, Verse 53). (4). Uddiyana Bandha (Abdominal Retraction Lock) #100/200/300/500 hour Yoga teacher training India Atha uddiyanabandhah Baddho yena sushumnayam pranastuddiyate yatah/ Tasmad uddiyanakhyoa yam yoghibhih samudahrtah// Uddiyana bandha is so-called by the yogis because through its practice the prana (is concentrated at one point and) rises through sushumna. (Chapter -3, Verse 55). Uddinam kurute yasmadavisrantam mahakhaghah/ Uddiyanam tadeva syattatra bandho abhidhiyate// The bandha explained is called the rising or flying bandha, because through its practice, the great bird Shakti flies upward with ease and comfortably. (Chapter -3, Verse 56). #100/200/300/500 hour Yoga teacher training India Udare paschimam tanam nabherurdhvam cha karayet / Uddiyano hyasau bandho mrtyumatangghakesari// Sucking the abdomen back in and making the navel rise is called Uddiyana Bandha. It is the lion which conquers the elephant death. (Chapter -3, Verse 57). (5). Moola Bandha(perineum/cervix retraction lock) Atha mulabandhah Parshnibhaghena sampidya yonim akunchayed ghudam/ Apanam urdhvam akrshya mulabandho abhidhiyate// Pressing the perineum/vagina with the heel and contracting the rectum so that the apana vayu moves upward it’s called moola bandha. (Chapter -3, Verse 61). #100/200/300/500 hour Yoga teacher training India Adhogatim apanam va urdhvagam kurute balat/ Akunchanena tam prahur mulabandham hi yoginah// By contracting the perineum the downward moving apana vayu is forced to go upward. Hatha Yogis called it as Moola Bandha. (Chapter -3, Verse 62). Gudam parshnya tu sampidya vayumakunchayed balat/ Varam varam yatha chordhvam samayati samiranah// Press the heel strongly against the rectum and contract forcefully and repeatedly, so that the prana energy rises. (Chapter -3, Verse 63). Pranapanau nadabindu mulabandhena chaikatam/ Gatva yogasya samsiddhim yachchato natra samsayah// There is no doubt that by practicing moola bandha, prana/apana and nada/bindu are joined, and total perfection gained.64 (6). Jalandhara Bandha (throat lock) Atha jalandharabandhah Kanthamakunchya hrdaye sthapayechchibukam drdham/ Bandho jalandharakhyoayam jaramrtyuvinasakah// Contracting the throat by bringing the chin to the chest sternum bone is the bandha called Jalandhara Bandha. It

May 30, 2017 No Comments

Hatha Yoga Pradipika – Chapter Two: Shatkarma and Pranayama

Hatha Yoga Pradipika – Chapter Two: Shatkarma and Pranayama Inter-connection of Mind and Prana and their controlling through Pranayama Chale vate chalam chittam nischale nischalam bhavet / Yogi sthanutvamapnoti tato vayum nirodhayet//(Chapter -2, Verse 2). When Prana moves, chitta the mental force too moves. When prana is still, Chitta also still without any movement. By this steadiness of prana the Hatha Yogi reaches stableness and should thus control the Vayu air. (Chapter -2, Verse 2). #100/200/300/500 hour Yoga teacher training India What is life and death; the functions of five Vayus Yavad vayuh sthito dehe tavaj jivanam uchyate / Maranam tasya nishkrantistato vayum nirodhayet//(Chapter -2, Verse 3). As long as the vayu (air and prana) remains in the body, that is called life. Death is when it leaves the body. Therefore, retain vayu. (Chapter -2, Verse 3). #100/200/300/500 hour Yoga teacher training India Cleansing of the Nadis and Chakras for retention of Prana Suddhameti yada sarvam nadichakram malakulam / Tadaiva jayate yogi pranasamghrahane kshamah//(Chapter -2, Verse 5). When all the nadis and chakras which are full of impurities are cleansed, then the hatha yogi is able to retain prana. (Chapter -2, Verse 5). #100/200/300/500 hour Yoga teacher training India Sattvic quality of mind and the three Gunas for pranayama Pranayamam tatah kuryannityam sattvikaya dhiya / Yatha sushumnanadistha malah suddhim prayanti cha//(Chapter -2, Verse 6). Therefore pranayama should, be practice daily with a sattvic quality of mind so that the impurities are removed out of sushumna nadi and cleanliness occurs. (Chapter -2, Verse 6). Times and duration of practice – Early morning, midday, evening and midnight, holding is step by step held up to eighty counts in one sitting. Pratarmadhyandine sayamardharatre cha kumbhakan/ Sanairasitiparyantam chaturvaram samabhyaset//(Chapter -2, Verse 11). Holding should be practiced perfectly four times a day: early morning, midday, evening and midnight, so that holding is step by step held up to eighty counts in one sitting. (Chapter -2, Verse 11). Signs and symptoms of right Pranayama practice Kaniyasi bhavedsveda kampo bhavati madhyame / Uttame sthanamapnoti tato vayum nibandhayet//(Chapter -2, Verse 12). At first stage there is sweating, in the middle stage trembling, in the last stage complete steadiness, and therefore the breath should be withheld. (Chapter -2, Verse 12). Diet and Pranayama – Milk and Ghee is recommended. At the beginning period of pranayama practice, food, consisting of milk and ghee is recommended very much. Upon being established in the practice such conditions are not necessary at all. (Chapter -2, Verse 14). #100/200/300/500 hour Yoga teacher training India Shatkarma should done before Pranayama if fat and mucus are Excessive Medasleshmadhikah purvam shatkarmani samacharet/ Anyastu nacharettani doshanam samabhavatah//. (Chapter -2, Verse 21). When fat or mucus is too much, shatkarma: the six cleansing practices should be done before pranayama practice. Others, in whom the doshas, i.e. phlegm, wind and bile (vata, pitta, kapha), are balanced should not perform them. (Chapter -2, Verse 21). Shatkarma – Six cleansing practices #100/200/300/500 hour Yoga teacher training India Dhautir bastis tathā netis trātakam naulikam tathā / Kapālabhātiś chaitāni shatkarmāni prachakshate//(Chapter -2, Verse 22). Dhauti, basti, neti, trataka, nauli and kapalbhati; these are called as shatkarma or the six cleansing processes. (Chapter -2, Verse 22). Freedom from the excesses of Doshas through Shatkarma (Chapter -2, Verse 36). By the six karmas (shatkarma) one is freed from excesses of the doshas. Then pranayama is practiced and success is achieved without strain. (Chapter -2, Verse 36). Eight Kumbhaka practices – Suryabheda, Ujjayi, Seetkari, Sheetali, Bhastrika,Bhramari, Moorchha and Plavini. (Chapter -2, Verse 44). #100/200/300/500 hour Yoga teacher training India i sitkari sitali tatha/ Bhastrika bhramari murchcha plavinityashtakumbhakah//(Chapter -2, Verse 44). The eight kumbhakas are suryabheda, ujjayi, seetkari, sheetali, bhastrika, bhramari, moorchha and plavini. (Chapter -2, Verse 44). By Maha Bandha, the Prana moves into the Brahma nadi #100/200/300/500 hour Yoga teacher training India Purakante tu kartavyo bandho jalandharabhidhah/ Kumbhakante rechakadau kartavyastuddiyanakah//(Chapter -2, Verse 45). At the end of inhalation, jalandhara bandha should be performed. At the end of kumbhaka and beginning of exhalation, uddiyana bandha should be performed. (Chapter -2, Verse 45). Adhastatkunchanenasu kanthasangkochane krte/ Madhye paschimatanena syatprano brahmanadighah//(Chapter -2, Verse 46). By contracting the perineum, contracting the throat and sucking the abdomen up, the prana moves into the brahma nadi. (Chapter -2, Verse 46). Pranayama three types, rechaka, pooraka, and kumbhaka. Pranayamas tridha prokto rechapurakakumbhakaih / Sahitah kevalascheti kumbhako dvividho matah// (Chapter -2, Verse 71). Pranayama is said to be of three types: exhalation (rechaka), inhalation (pooraka), and retention (kumbhaka). Kumbhaka is again of two types: connected sahita and unconnected kevala. (Chapter -2, Verse 71). #100/200/300/500 hour Yoga teacher training India Yavat kevalasiddhih syat sahitam tavad abhyaset/ Rechakam purakam muktva sukham yadvayudharanam//(Chapter -2, Verse 72). Till attain perfection in kevala kumbhaka, sahita kumbhaka has to be practiced. When you are freed of inhalation/exhalation then the breath/prana is ceased spontaneously. (Chapter -2, Verse 72). Pranayamoa yam ityuktah sa vai kevalakumbhakah/ Kumbhake kevale siddhe rechapurakavarjite//(Chapter -2, Verse 73). Perfection of isolated holding is freedom from inhalation and exhalation process. This pranayama spoken of is verily kevala kumbhaka. (Chapter -2, Verse 73). Na tasya durlabham kimchittrishu lokeshu vidyate/ Saktah kevalakumbhena yatheshtam vayudharanat//(Chapter -2, Verse 74). Nothing in the three worlds of existence is unobtainable by him who has mastery over kevala kumbhaka and can hold the breath as desired time. (Chapter -2, Verse 74). #100/200/300/500 hour Yoga teacher training India

May 30, 2017 No Comments

Introduction to Human Anatomy and Physiology

Introduction to Human Anatomy and Physiology Anatomy #100/200/300/500 hour Yoga teacher training India It is the science that deals with the structures of the human body and its relationship of various parts to each other. The subject matter of anatomy includes Histology – Study of tissues Osteology – Study of bones Mycology – Study of muscles Arthrology – Study of Joints Splanchnology – Study of organs Neurology – Study of Nervous System Physiology #100/200/300/500 hour Yoga teacher training India It is the science which deals with the functions of the body. It explains how various systems in the body function together normally as a single unit. The subject matter of physiology includes the study of various systems like. Central nervous system Cardio vascular system Digestive system Excretory system Respiratory system Reproductive system etc., Cell #100/200/300/500 hour Yoga teacher training India Each and every part of our body is composed of tiny microscopic units, the Cell. Cell is the structural and functional unit of the body. Cells have different shapes and sizes according to their nature of work Tissues #100/200/300/500 hour Yoga teacher training India Cells are highly organised units but they do not function in isolation. They work together in a group of similar cells called tissue. Every tissue has got its specialized function to perform. TYPES Epithelial tissue Connective tissue Muscular tissue Nervous tissue Epithelial Tissue It covers the body surfaces and forms gland. It forms external layer of the skin, internal living the mucus membrane of the body cavities and the hollow organs. Functions Secretion Protection Absorption Excretion Connective Tissue #100/200/300/500 hour Yoga teacher training India It includes the blood cells, loose and dense (fiber) connective tissue, adipose tissue, lymph cartilages and bones. Major function of connective tissue is to connect, anchor and support the other tissues of the body and to form structural frame work of the body. Muscular Tissue #100/200/300/500 hour Yoga teacher training India It is responsible for movements of the body and organs. This is because of its characteristic function of contraction. It forms mainly three types of muscle fibres. Cardiac muscle Smooth muscle Striated or Skeletal muscle Functions #100/200/300/500 hour Yoga teacher training India Motion is an essential body function which results from the contraction and relaxation of muscles. Maintenance of posture and Heat production. Nervous Tissue It forms the whole nervous system. It initiates and transmits nerve impulses that coordinate the body and its surrounding environment. The main properties of this tissue are excitability and conductivity nervous tissue responds to various stimuli. Nervous tissue is composed of nerve cells and their processes. These processes born the nerve fibers. Such unit of nervous tissue is known as neuron. They construct the nerves in the body. Organs #100/200/300/500 hour Yoga teacher training India Different kinds of tissues are joined together to form higher level of organisation. i.e. organ Organs have recognizable shape. Each organ has a complex structure and it performs a specific function of the body. Examples Liver, Heart, Brain, Lungs, Stomach ete System #100/200/300/500 hour Yoga teacher training India A system is an association of organs that have a common function. Types and various systems in the human body There are 11 major systems such as Skeletal system Muscular System Digestive system Respiratory system Nervous system Circulatory System Urinary System Endocrine system Reproductive system Integument system Immune system #100/200/300/500 hour Yoga teacher training India

May 20, 2017 No Comments

Need of Anatomy and Physiology in Yoga

Need of Anatomy and Physiology in Yoga #100/200/300/500 hour Yoga teacher training India Knowledge of anatomy and physiology forms the basis for the study of biological sciences. Even for a common man, to understand the heath problems and their solution. Preliminary knowledge of this subject is helpful. Today yogic practices have become popular throughout the world. The yogic practices have been included in school and college curriculum where yoga teacher imparts the yoga training consisting of mainly asanas, pranayamas and kriyas etc. These practices involve our bodily structure and function. In order to understand how the yogic practices influence our body and mind, a student and teacher should know the basic anatomy and physiology as well as the physiological changes brought about by the yogic practices. Having this knowledge, one will be able to employ the technique systematically for the students or the patients. The importance of this subject was realized by the concerned authorities and now this subject has been introduced in the field of education and other faculties. #100/200/300/500 hour Yoga teacher training India The whole approach in studying the basic principles of anatomy and physiology is to understand the probable mechanisms involved in various yogic practices on the scientific background. It is obvious that our body responds according to the nature of stimulation from the external or the internal environments. Yogic practices work deep inside the body and mind and are expected to bring about some changes in the behavioral pattern of even a normal individual so as to prepare him for the higher yogic practices. There fore our yogic techniques should bear a scientific background along with the traditional support. This scientific background would also help the individual to remove confusion or misconception. If any, regarding the technique and the results of the yogic practices. He would then be the best yoga teacher to guide his students on the path of yoga. #100/200/300/500 hour Yoga teacher training India

May 20, 2017 No Comments

Hatha Yoga Pradipika – Who can practice Yoga?

Hatha Yoga Pradipika – Who can practice Yoga? Yuvo vrddhoativrddho va vyadhito durbaloapi va / Abhyasat siddhim apnoti sarvayogheshvatandritah//(Chapter -1, Verse -64). Either, Young or old, very old, sick or feeble, one can attain perfection in all the Yogas by regular constant practicing. (Chapter -1, Verse – 64). #100/200/300/500 hour Yoga teacher training India

May 19, 2017 No Comments

Hatha Yoga Pradipika – Food conducive for Hatha Yogic Practices

Hatha Yoga Pradipika – Food conducive for Hatha Yogic Practices Ghodhuma-sali-yava-shashtika-sobhanannam / Kshirajyakhanda-navanitasi hamadhuni// Sunthipatolakaphaladikapanchasakam / Mudghadidivyam udakam cha yamindrapathyam//(Chapter -1, Verse -62). #Yoga course Bangalore The most supporting foods for the Hatha Yogic practices are: good grains, wheat, rice, barley, milk, ghee, brown sugar, sugar candy (crystallized sugar), honey, dry ginger, patola fruit (species of cucumber), five vegetables, mung, pulses, and pure water. (Chapter -1, Verse -62). #Yoga course Bangalore Pushtam sumadhuram snighdham Gavyam dhatupraposhanam / Manobhilashitam yoghyam yogi bhojanamacharet//(Chapter -1, Verse-63). The Hatha Yogi should take nourishing and sweet food mixed with, ghee and milk; it should nourish the dhatus (basic body constituents) and be pleasing and suitable for body-mind-soul. (Chapter -1,Verse-63). #Yoga course Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika – Food Prohibited for Hatha Yogic Practices

Hatha Yoga Pradipika – Food Prohibited for Hatha Yogic Practices Katvamla-tikshna-lavanoshna-haritasaka / Sauvira-taila-tila-sarshapa-madya-matsyan // Ajadi-mamsa-dadhi-takra-kulattha-kola / Pinyaka-hingghu-lasunady-amapathyam-ahuh//(Chapter -1, Verse- 59). #Yoga course Bangalore The foods which prohibited for the Hatha Yogic practitioners are: those which are bitter, sour, pungent, salty, heating, green vegetables, sour gruel, oil, sesame and mustard, alcohol, fish, flesh foods, curds, buttermilk, horse gram, fruit of jujube, oil cakes, asafetida and garlic. (Chapter -1, Verse- 59). Bhojanam ahitam vidyāt punarasyoshnīkrtam rūksham/ Atilavanamam layuktam kadaśanaśākotkam varjyam// (Chapter -1, Verse -60). #Yoga course Bangalore Unnourishing food should not be consumed, that which is reheated after becoming cold, which is dry (devoid of natural oil), which is excessively salty or acidic, stale or has too many mixed vegetables. (Chapter -1, Verse -60). #Yoga course Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika -Moderate diet for Hatha Yogic Practices

Hatha Yoga Pradipika -Moderate diet for Hatha Yogic Practices Susnighdhamadhuraharaschaturthamsavivarjitah / Bhujyate sivasamprityai mitaharah sa uchyate//(Chapter -1, Verse -58). Mitahara is defined as agreeable and sweet food, leaving one fourth of the stomach free, and eaten. (Chapter -1, Verse-58). #Yoga course Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika – Four best asanas according to Shiva

Hatha Yoga Pradipika – Four best asanas according to Shiva Four best asanas among eighty four taught by Shiva Chaturasityasanani sivena kathitani vai / Tebhyas chatushkam adaya sarabhutam bravimyaham//(Chapter -1, Verse -33) Among all the eighty-four Asanas were taught by Shiva. Out of those ‘I’ shall now describe the four important Asanas. (Chapter -1, Verse-33) #200 hour Yoga teacher training certificate course in Bangalore Siddham padmam tatha simham bhadram veti chatushtayam/ Sreshtham tatrapi cha sukhe tishthetsiddhasane sada//(Chapter -1, Verse-34) Siddhasana, padmasana, simhasana and bhadrasana, these are the four essential Asanas. Always sit comfortably in Siddhasana because it is the bestamong all the asanas. (Chapter -1, Verse-34) #200 hour Yoga teacher training certificate course in Bangalore (1). Siddhasana (Adept’s Pose) Yonisthanakam angghrimulaghatitam Krtva drdham vinyaset / Mendhre padam athaikameva hrdaye Krtva hanum susthiram // Sthanuh samyamitendriyoa chaladrsa pasyed bhruvor antaram/ Hyetan mokshakapatabhedajanakam Siddhasanam prochyate//(Chapter -1, Verse -35) #200 hour Yoga teacher training certificate course in Bangalore Press the perineum with the heel of one foot, place the other foot on top of the genitals. Having done this, rest the chin on to the chest. Remaining still and steady, with the senses controlled, gaze steadily into the eyebrow center; it breaks open the door to liberation. This is called siddhasana. (Chapter -1, Verse -35). #200 hour Yoga teacher training certificate course in Bangalore (2). Padmasana (lotus pose) Vamorupari dakshinam cha charanam Samsthapya vamam tatha / Dakshorupari paschimena vidhina Dhrtva karabhyam drdham // Angghushthau hrdaye nidhaya Chibukam nasaghramalokayet / Etadvyadhivinasakari yaminam Padmasanam prochyate//(Chapter -1, Verse 44) Place the right foot on the left thigh and the left foot on the right thigh, cross the hands behind the back and firmly hold the toes. Press the chin against the chest and look at the tip of the nose. This is called padmasana, the destroyer of a yogi’s diseases. (Chapter -1, Verse- 44). Uttanau charanau krtva urusamsthau prayatnatah / Urumadhye tathottanau pani krtva tato drsau//(Chapter -1, Verse-45) Place the feet on the thighs, soles upward, palms in the middle of the groin, facing upward. (Chapter -1, Verse-45). Nasaghre vinyasedrajadantamule tu jihvaya/ Uttambhya chibukam vakshasyutthapy pavanam sanaih//(Chapter -1, Verse-46) Gaze at the nose tip, keeping the tongue pressed against the root of the upper teeth and the chin against the chest, and slowly raise the prana upward. (Chapter -1, Verse-46) Idam padmasanam proktam sarvavyadhivinasanam/ Durlabham yena kenapi dhimata labhyate bhuvi//(Chapter -1, Verse-47) This is called padmasana, destroyer of all diseases. Ordinary people cannot achieve this posture, only the few wise ones on this earth can do. (Chapter -1, Verse -47) (3). Simhasana (lion’s pose) Ghulphau cha vrshanasyadhah Sivantyah parsvayoh kshipet/ Dakshine savyaghulpham tu Dakshaghulpham tu savyake//(Chapter -1, Verse-50). Place the ankles below the scrotum, right ankle on the left side, left ankle on the right side of the perineum. (Chapter -1,Verse-50). Hastau tu janvoh samsthapya Svangghulih samprasarya cha / Vyattavaktro niriksheta nasaghram susamahitah// (Chapter -1, Verse-51). Place the palms on the knees, fingers spread apart, keep the mouth open and gaze at the nose tip with a concentrated mind.(Chapter -1, Verse-51). #200 hour Yoga teacher training certificate course in Bangalore Simhasanam bhavedetatpujitam yoghipungghavaih / Bandhatritayasandhanam kurute chasanottamam//(Chapter -1, Verse-52). This is simhasana, held in great esteem by the highest yogis. This most excellent asana facilitates the three bandhas. (Chapter -1, Verse-52). (4). Bhadrasana (gracious pose) Ghulphau cha vrshanasyadhah Sivantyah parsvayoh kshipet / Savyaghulpham tatha savye Dakshaghulpham tu dakshine // Parsvapadau cha panibhyam Drdham baddhva sunischalam / Bhadrasanam bhavedetatsarvavyadhivinasanam //(Chapter -1, Verse- 53). #200 hour Yoga teacher training certificate course in Bangalore Place the ankles below the genitals on the sides by the perineum, left ankle on the left (side) right ankle on the right (side).(Chapter -1, Verse- 53). Ghorakshasanamityahuridam vai siddhayoghinah/ Evamasanabandheshu yogindro vighatasramah // Abhyasennadikasuddhim mudradipavanakriyam/(Chapter -1, Verse-54). Then hold the feet, which are on their sides, firmly with the hands and remain motionless. This is bhadrasana which destroys all diseases. The yogis who are perfected (siddhas) call it gorakshasana. (Chapter -1, Verse-54). #Yoga course Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika – Asanas according to Vashishtha & Matsyendranath

Hatha Yoga Pradipika – Asanas according to Vashishtha & Matsyendranath Vasishthadyais cha munibhir matsyendradyais cha yogibhih/ angikrtanyasanani kathyante kanichin maya//(Chapter -1, Verse 18). I will proceed to explain some of the Asana accepted by adept munis like Vashishtha and Yogis such as Matsyendranath. (Chapter -1, Verse 18). #200 hour Yoga teacher training certificate course in Bangalore (1). Swastikasana (auspicious pose) Janurvor antare samyak krtva padatale ubhe / Rjukayah samasinah svastikam tat prachakshate//(Chapter -1, Verse 19). Placing both soles of the feet on the inner side of the thighs, sitting equipoised with a straight body. This is called swastikasana). (Chapter -1, Verse 19). (2). Gomukhasana (Cow’s Face Pose) Savye dakshinaghulpham tu prshthaparsve niyojayet / Dakshineapi tatha savyam ghomukham ghomukhakrtih//(Chapter -1, Verse 20). Place the right ankle next to the left buttock and the left ankle next to the right buttock. This is gomukhasana and it looklike the face of the cow. (Chapter -1, Verse 20). (3). Veerasana (Hero’s Pose) Ekam padam tathaikasmin vinyased uruni sthiram / Itarasmims tatha chorum virasanam itiritam//(Chapter -1, Verse 21). Placing one foot by the opposite thigh and the other foot under the same thigh, its called as veerasana. (Chapter -1, Verse 21). (4). Koormasana (Tortoise Pose) Ghudam nirudhya ghulphabhyam vyutkramena samahitah/ Kurmasanam bhavedetaditi yogavido viduh//(Chapter -1, Verse 22). Press the anus firmly with the ankles in the opposite direction and sit well-poised. According to the Yogis this is called as Koormasana. (Chapter -1, Verse 22). (5). Kukkutasana (Cockerel Pose) Padmasanam tu samsthapya janurvorantare karau / Nivesya bhumau samsthapya vyomastham kukkutasanam//(Chapter -1, Verse 23). By adopting Padmasana, insert the hands between the thighs and calves, planting them the hands firmly on the ground; raise the body in the air. This is called as Kukkutasana. (Chapter -1, Verse 23). (6). Uttan Koormasana (Stretching Tortoise Pose) Kukkutasanabandhastho dorbhyam sambadya kandharam/ Bhaved kurmavad uttana etad uttanakurmakam//(Chapter -1, Verse 24). By adopting Kukkutasana, unite both the hands at the shoulders and lie flat on the back like a tortoise. This is called as Uttankoormasana. (Chapter -1, Verse 24). (7). Dhanurasana (Bow Pose) Padanghushthau tu panibhyam ghrhitva sravanavadhi / Dhanurakarshanam kuryad dhanurasanam uchyate//(Chapter -1, Verse 25). Holding the toes with the hands, pull them up to the ears as if drawing a bow. This is called Dhanurasana. (Chapter -1, Verse 25). (8). Matsyendrasana (Spinal Twist Pose) Vamoru mularpitadakshapadam Janor bahir veshtitavamapadam/ Praghrhya tishthet parivartitangghah srimatysanathoditam asanam syat//(Chapter -1, Verse 26). Place the right foot at the base of the left thigh, the left foot at the side of the right knee. Take hold of the left foot with the right hand, pass the left arm behind the waist and remain with the body turned. This asana is explained by Sri Matsyendranath. (Chapter -1, Verse 26). Matsyendrapitham jatharapradiptim Prachandarughmandalakhandanastram/ Abhyasatah kundaliniprabodham Chandrasthiratvam cha dadati pumsam//(Chapter -1, Verse 27). Practice of this asana Matsyendrasana increases the digestive fire to such an incredible capacity, this will eradicate all stomach diseases and thus awakening the serpent power and bringing equilibrium in the Bindu. (Chapter -1, Verse 27). (9). Paschimottanasana (Back Stretching Pose) Prasarya padau bhuvi dandarupau Dorbhyam padaghradvitayam ghrhitva/ Januparinyastalalatadeso Vasedidam paschimatanamahuh.// (Chapter -1, Verse 28). Stretching the legs in front on the ground, like a stick; bending forward, holding the toes with both hands and placing the forehead on the knees, is known as Paschimottanasana. (Chapter -1, Verse 28). Paschimottanasana Iti paschimatanamasanaghryam Pavanam paschimavahinam karoti/ Udayam jatharanalasya kuryad Udare karsyamaroghatam cha pumsam//(Chapter -1, Verse 29). Paschimottanasana is the best among asanas. By this asana the pranic currents rise through sushumna, the digestive fire stimulates, the abdomen becomes flat, and the practitioner becomes free from all kind of diseases. (Chapter -1, Verse 29). (10). Mayurasana (Peacock Pose) Dharam avashtabhya karadvayena Tatkurparasthapitanabhiparsvah/ Uchchasano dandavad utthitah san Mayuram etat pravadanti pitham//(Chapter -1, Verse 30). Lie down on the stomach, placing both hands on the ground under the body and place the elbows at the sides of the navel. Raise the body high, keeping it like a stick. This is called peacock pose by the expert Yogis. (Chapter -1, Verse 30). Harati sakalaroghanasu ghulmodaradin Abhibhavati cha doshanasanam srimayuram/ Bahu kadasanabhuktam bhasma kuryadasesham Janayati // jatharaghnim jarayetkalakutam/(Chapter -1, Verse 31). Mayurasana quickly alleviates all diseases like enlargement of the glands, dropsy and other stomach disorders. It rectifies imbalance of the humors (vata, pitta, kapha). It reduces to ashes all food taken indiscriminately, kindles the gastric fire and enables destruction of deadly poison). (Chapter -1, Verse 31). (11). Shavasana (Corpse Pose) Uttanam sabavad bhumau sayanam tat savasanam/ Savasanam srantiharam chittavisrantikarakam//(Chapter -1, Verse 32). Lying flat on the ground with the face upwards, in the manner of a dead body, is savasana. It removes tiredness and enables the mind-body complex to relax deeply. (Chapter -1, Verse 32).

May 19, 2017 No Comments

Hatha Yoga Pradipika – Causes of success in sadhana

Hatha Yoga Pradipika – Causes of success in sadhana Utsahat sahasad dhairyat tattvajnanas cha nischayat/ Janasangghaparityaghat shadbhir yogah prasiddhyati// (Chapter -1, Verse -16). Enthusiasm, perseverance, discrimination, strong faith, courage, avoiding the company of common people, are the (six causes) which bring success in Hatha Yoga. (Chapter -1, Verse – 16). #200 hour Yoga teacher training certificate course in Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika –Causes of failure in Sadhana

Causes of failure in sadhana- Overeating, exertion, talkativeness, adhering to rules, company of common people and wavering mind Atyaharah prayasascha prajalpo niyamaghrahah/ janasangascha laulyam cha shadbhiryogo vinasyati//(Chapter -1, Verse -15). Overeating, exerting physically & mentaly, talking too much, adhering to rules, being in the company of common people and unstable mind are the six (causes) which destroy yoga. (Chapter -1, Verse -15). #200 hour Yoga teacher training certificate course in Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika – Practice Yoga without mental tension

Practice of sadhana devoid of mental tension, according to guru’s instruction Evam vidhe mathe sthitva sarvachintavivarjitah / ghurupadishtamargena yogameva samabhyaset // (Chapter -1, Verse -14) In this way, dwelling in the hermitage, being devoid of all mental tensio ,Hatha Yoga should be practiced in the way instructed by the Guru. (Chapter -1, Verse -14). #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika – Place for Yoga practice

Hatha Yoga Pradipika – Place for Yoga practice Surajye dharmike dese subhikshe nirupadrave / dhanuh pramanaparyantam silagnijalavarjite / Ekante mathikamadhye sthatavyam hathayogina // (Chapter -1, Verse- 12). The Hatha Yoga practitioner should live alone in a hermitage and practice in a place the length of a bow (one and a half meters), where there is no hazard from rocks, fire or water, and which is in a well-administered and virtuous kingdom (nation or town) where good alms can be easily attained, without any dificulties. (Chapter -1, Verse – 12). Alpadvaram arandhragartavivaram atyuchchanichayatam/ Samyaggomayasandraliptam amalam nihsesajantujjhitam / Bahye mandapavedikuparuchiram prakarasamveshtitam / proktam yogamathasya lakshanam idam siddhair hathabhyasibhih // (Chapter -1, Verse – 13). Hatha Yoga hermitage as prescribed by the siddhas for the Hatha Yoga practitioners. The room for spiritual practice should have a small door, without any aperture (window), holes or cracks, being neither too high nor too low. It should be spotlessly clean, wiped with cow dung and free from animals or insects. Outside, there should be an open platform with a thatched roof, a well and a surrounding wall (fence). The appearance of the hermitage should be pleasant auspicious. (Chapter -1, Verse -13). #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika – Sadhana should be kept secret for success

Hatha Yoga Pradipika – Sadhana should be kept secret for success Hathavidya param gopya yogina siddhimichchata / bhavedviryavati gupta nirvirya tu praksita // (Chapter -1, Verse – 11). Hatha yoga practice is the greatest secret of the yogis who wish to achieve perfection (siddhi). Indeed, to be fruitful, it must be kept secret; revealed it becomes powerless. (Chapter -1,Verse – 11). #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika – Three types of Pain or tapas(Yoga teacher training course in India)

Three types of Pain or tapas (adhyatmik – spiritual, adhidevik – environmental and adhibhautik – physical). Aseshatapataptanam samasrayamatho hathah / aseshayogayuktanamadharakamatho hathah // (Chapter -1, Verse -10). For those continually tempered by the heat of tapas or austerities (the three types of pain – spiritual, environmental and physical) Hatha Yoga is like the hermitage giving protection from the heat. (Chapter -1, Verse -10). #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore

May 19, 2017 No Comments

Hatha Yoga Pradipika – Aim of Hatha Yoga

Hatha Yoga Pradipika – Aim of Hatha Yoga Pranamya srighurum natham svatmaramena yogina / kevalam rajayogaya hathavidyopadisyate //(Chapter -1, Verse -2). Prostrating first to the guru lord Shiva, Yogi Swatmarama instructs the knowledge of Hatha Yoga only, for those who aspiring (raja yoga) the highest state of yoga. (Chapter -1, Verse -2). Bhrantya bahumatadhvante rajayogamajanatam / hathapradipikam dhatte svatmaramah krpakarah // (Chapter -1, Verse -3). The highest state of raja yoga is obscure due to misconceptions (darkness) created by varying ideas and concepts. In good will and as a blessing, Swatmarama gives light on hatha yoga. (Chapter -1, Verse -3). #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore

May 19, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada – Fruits of Meditation(1.40)

Patanjali Yoga Sutra – Samadhi Pada – Fruits of Meditation(1.40) Fruits of Meditation 1.40. Paramanu-paramamahattvanto’sya vasikarah| Paramanu-ultimate atom Paramamahattva- ultimately largeness Antah-ending Asya-of this Vasikarah-mastery So the yogi is given mastery over all objects for meditation ranging from the smallest atom to the infinitely large.

May 13, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada – By Meditation as Desired(1.39)

Patanjali Yoga Sutra – Samadhi Pada – By Meditation as Desired(1.39) By Meditation as Desired 1.39. Yathabhimatadhyanadva| Yatha-as Abhimata-desired Dhyanad-by meditation Va-or Or else by meditation as desired(mind can be steadied). #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course

May 13, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada-By Knowledge of Dream and Sleep(1.38)

Patanjali Yoga Sutra – Samadhi Pada – By Knowledge of Dream and Sleep(1.38) By Knowledge of Dream and Sleep 1.38. Svapnanidrajnanalambanam va| Svapna-dream Nidra-sleep Jnana-knowledge Alambana-support Va-or, also Or else (the mind can be made steady) by giving it the knowledge of dream and sleep for support. #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course

May 13, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada- By Detachment from matter(1.37)

Patanjali Yoga Sutra – Samadhi Pada- By Detachment from matter(1.37) By Detachment from matter 1.37. Vitaragavisayam va chittam| Vitaraga-passionless person who has transcended raga Visayam-object Va-or Chittam-mind Or the else mind can bebrought under control bymaking passionless persons the object for concentrating the mind. #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course

May 13, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada-By Inner Illumination(1.36)

Patanjali Yoga Sutra – Samadhi Pada-By Inner Illumination(1.36) By Inner Illumination 1.36. Visoka va jyotismati| Visoka-without sorrow Va-or Jyotismati-luminous, full of light Or the luminous state which is beyond sorrow (can control the mind). #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course

May 13, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada-By Observing Sense Experience(1.35)

Patanjali Yoga Sutra – Samadhi Pada-By Observing Sense Experience(1.35) By Observing Sense Experience 1.35. Visayavati va pravritirutpanna manasah sthitinibandhani| Visayavati- sensuos Va-or Pravritih-functioning Utpanna-arisen Manasah-of the mind Sthiti-steadiness Nibandhani-which binds Or else mind can be made stad by bringing it into activity of sense experience. #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course

May 13, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada- By Controlling Prana(1.34)

Patanjali Yoga Sutra – Samadhi Pada- By Controlling Prana(1.34) By Controlling Prana 1.34. Pracchardanavidharan abyam va pranasya| Pracchardana-expiration or rechaka Vidharanabyam-holding, kumbhaka Va-or Pranasya-of breath Or by expiration and retention of breath (one can control the mind). #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course

May 13, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada-Or by Cultivatiing Oppostie Virtues(1.33)

Patanjali Yoga Sutra – Samadhi Pada-Or by Cultivating Opposite Virtues(1.33) Or by Cultivating Opposite Virtues 1.33. Maitrikarunamuditopeksanam sukhaduhkhapunyapunyavisayanam bhavanataschittaprasadanam| Maitri- friendliness Karuna-compassion Mudita-gladness Upeksanam-indifference Sukha-happiness Duhkha-misery Punya-virtue Apunya-vice Visayanam-of the objects Bhavanatah-attitude Chitta-mind Prasadanam-purification, making peaceful In relation to happiness, misery, virtue and vice, by cultivating the attitude of friendliness, compassion, gladness and indifference respectively, the mind becomes purified and peaceful. #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course

May 13, 2017 No Comments

Patanjali Yoga Sutra/Samadhi Pada/ Removal of obstacles by Concentration(1.32)

Patanjali Yoga Sutra/Samadhi Pada/ Removal of obstacles by Concentration(1.32) Removal of obstacles by One-pointedness 1.32. Tatpratisedharthamekatvabhyasah, Tat-that Pratisedhartham-for removal Eka-one Tattva-principle Abhyasah-practice For removal of those (obstacles and accompanying symptoms) the practice of concentration on one principal (is to be done). #Yin, Restorative, Hatha, Vinyasa, Yoga Therapy Teacher Training Certificate Course

May 13, 2017 No Comments

Patanjali Yoga Sutra-Samadhi Pada-Obstacles can be removed by one-pointedness(1.31)

Patanjali Yoga Sutra-Samadhi Pada-Obstacles can be removed by one-pointedness(1.31) Obstacles can be removed by one – pointedness 1.31. Duhkhadaurmanasyangamejayatvasvasaprasvasaviksepasahabhuvah| Duhkha-pain Daurmanasya- depression Angamejayatva-shaking of the body Svasaprasvasa-inhalations and exhalations Viksepa-distraction Sahabhuvah-accompanying symptom Pain, depression, shaking of the body and unrhythmic breathing are the accompanying symptoms of mental distraction. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore

May 13, 2017 No Comments

Patanjali Yoga Sutra – Samadhi Pada- Obctacles in Path of Yoga Practice(1.30)

Patanjali Yoga Sutra – Samadhi Pada- Obstacles in Path of Yoga Practice(1.30) Obstacles in Path of Yoga Practice 1.30. Vyadhistyanasamsayapramadalasyaviratibhranti-darsanalabdha bhumikatvanavasthitatvani cittaviksepaste’ntarayah| Vyadhi-disease Styana-dullness Samsaya-doubt Pramada-procrastination alasya-laziness avirati-craving for enjoyment bhrantidarsana-errenous perception alabdhabhumikatva- inability to achieve finer state anavasthitatva-instability cittaviksepah-obstacle to the mind te-they antarayah-obstacles Disease, dullness, doubt, procrastination, laziness, craving, erroneous perception, inability to achieve finer stages nad instabiity are the obstacles. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore

May 13, 2017 No Comments

ONLINE TTC

TTC -1

TTC -2

TTC -3

Important Links

Courses We Offer

Contact

Address: