Patanjali Yoga Sutra – Kaivalya Pada Potentiality of object 4.14. Parinamaikatvadvastutattvam| Parinama-transformation Ekatvat-due to oneness Vastu-object Tattvam-the essence The potential of the object is due
Patanjali Yoga Sutra – Kaivalya Pada – Dominance of action or karma 4.7. Karmasuklakrsnam yoginastrividhamitaresam| Karma-action Asukla-not white Akrsnam-not black Yoginah-of the yogis Trividham-threefold Itaresam-of
Patanjali Yoga Sutra – Kaivalya Pada Vanishing of impressions 4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah| Hetu-cause Phala-effect Asraya-support Alambanaih-object Sangrhitatvat-because of being bound together Esam-of these Abhave-on
Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions 4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat| Jati-class of birth Desa-place Kala-time Vyavahitanam-separated Api-even Anantaryam-sequence Smrtisamskarayoh-of memory and impressions Ekarupatvat-because
The Heart, Arteries & Veins Forms the Circulatory System: The heart pumps blood into arteries. The arteries divide and subdivide and finally end in capillaries.
Measurement of blood pressure: Blood pressure is usually measured by an instrument called sphygmomanometer; it consists of a mercury manometer. Cuff and hand pump. The
Unmani Avastha Tare jyotishi samyojya kimchidunnamayed bhruvau/ Purvayogam mano yunjannunmanikarakah kshanat// Fix the gaze on the tip of the nose and raise the eyebrows a
Sound is shakti and dissolves in consciousness Yatkinchin nadarupena sruyate saktireva sa / Yas tattvanto nirakarah sa eva paramesvarah// Whatever is heard of the nature
Shambhavi Mudra (eyebrow center gazing) Shambhavi mudra (eyebrow center gazing) internalizes pranic flow and mind – If the Hatha Yogi remains with the chitta and
Prana and mind are controlled through each other Pavano badhyate yena manastenaiva badhyate / Manascha badhyate yena pavanastena badhyate// Through controlling the prana, thought is
Parichaya Avastha (stage of increase) Stage of increase – Sound of the drum, perfection or siddhi. Imbalance of the three humors or doshas, pain, old
The main bones of the human skeleton are: The Skull – Cranium, Mandible, and Maxilla Shoulder girdle – clavicle and scapula Arm – humerus, radius,
Nishpatti Avastha (state of consummation) Nishpatti avastha or state of consummation – Rudra granthi is pierced, the fire of prana flows to the place of
Nada anusandhana – exploration of sound “OM” Nada anusandhana – exploration of sound”OM” – Closing the ears, nose and mouth, a clear, clear sound is
Mind dissolves in Samadhi Mind dissolves in Samadhi – As camphor burnt in fire, and salt mix in the sea, in samadhi mind dissolves into
Mind – Senses, Prana – Mind, Nada – Prana Indriyanam mano natho manonathastu marutah/ Marutasya layo nathah sa layo nadamasritah// Mind is the controller of
Manonmani (consciousness without mind) State Manonmani (consciousness without mind) – Manonmani is obtained when prana flows in sushumna nadi Sushumnavahini prane siddhyatyeva manonmani/ Anyatha tvitarabhyasah
Kundalini is to be blocked at Brahmarandhra Nadi The ultimate union and samadhi happens at sahasrara chakra. This location is at the crown of the
Karmas get annihilated when prana flows in Sushumna Nadi All Karmas(actions) get annihilated when prana flows in sushumna nadi, mind remain in complete shoonya(void).
Ghata Avastha (vessel stage) Ghata avastha (vessel stage) – Vishnu granthi is pierced the greatest bliss is revealed. Then from that emptiness the sound of
Ending of Prana and Mind in Samadhi state Ending of Prana and Mind in Samadhi state – Activities of prana is annihilated, then mind is
Factors affecting blood pressure: Blood volume. Cardiac output Peripheral resistance. The elasticity of blood vessels. The diameter of the lumen of blood vessels. The viscosity
Concentration on nada burns ‘bad karma’ Concentration on nada burns ‘bad karma’ – Bad karma’(sin) is destroyed by constant concentration on nada. The finite mind
Chitta has two qualities: vasana and prana Hetudvayam tu chittasya vasana cha samiranah / Tayorvinashta ekasmintau dvavapi vinasyatah// Chitta has two qualities, vasana and prana.
Arambha Avastha (beginning stage) Arambha avastha (beginning stage) – When the Hatha Yogi experiences arambha in the void of the heart, his body becomes lustrous
Disorders of Heart Cardiac failure: It’s a condition in which the myocardium of ventricle is unable to maintain sufficient circulation of blood to meet the
Vipareeta Karani Mudra (reversing attitude) Urdhvanabheradhastalorurdhvam bhanuradhah sasi / Karani viparitakha ghuruvakyena labhyate// With the navel region above and the palate below, the sun is
Uddiyana Bandha (Abdominal Retraction Lock) Atha uddiyanabandhah Baddho yena sushumnayam pranastuddiyate yatah/ Tasmad uddiyanakhyoa yam yoghibhih samudahrtah/ Uddiyana bandha is so-called by the yogis because
Moola Bandha(perineum/cervix retraction lock) Atha mulabandhah Parshnibhaghena sampidya yonim akunchayed ghudam/ Apanam urdhvam akrshya mulabandho abhidhiyate// Pressing the perineum/vagina with the heel and contracting the
Maha Vedha Mudra (Great Piercing Attitude) Atha mahavedhah Mahabandhasthito yogi krtva purakam ekadhih/ Vayunam ghatimavrtya nibhrtam kanthamudraya// The Hatha Yogi, in the position of Maha
Maha Mudra (The Great Attitude) Padamulena vamena yonim sampidya dakshinam/ Prasaritam padam krtva karabhyam dharayeddrdham//(Chapter -3, Verse 10). Press the left heel into the perineum
Maha Bandha (Great Lock) Parshnim vamasya padasya yonisthane niyojayet/ Vamorupari samsthapya dakshinam charanam tatha// Press the heel of the left foot in the perineum or
Jalandhara Bandha (throat lock) Atha jalandharabandhah Kanthamakunchya hrdaye sthapayechchibukam drdham/ Bandho jalandharakhyoayam jaramrtyuvinasakah// Contracting the throat by bringing the chin to the chest sternum bone
What is life and death? What is life and death; the functions of five Vayus Yavad vayuh sthito dehe tavaj jivanam uchyate / Maranam
Times and duration of Pranayama practice Times and duration of practice – Early morning, midday, evening and midnight, holding is step by step held up
Signs and symptoms of right Pranayama practice Kaniyasi bhavedsveda kampo bhavati madhyame / Uttame sthanamapnoti tato vayum nibandhayet//(Chapter -2, Verse 12). At first stage there
Sattvic quality of mind and the three Gunas for pranayama Practice Pranayamam tatah kuryannityam sattvikaya dhiya / Yatha sushumnanadistha malah suddhim prayanti cha//(Chapter -2,
Pranayama three types, rechaka, pooraka, and kumbhaka. Pranayamas tridha prokto rechapurakakumbhakaih / Sahitah kevalascheti kumbhako dvividho matah// (Chapter -2, Verse 71). Pranayama is said to
Cleansing of the Nadis and Chakras for retention of Prana Suddhameti yada sarvam nadichakram malakulam / Tadaiva jayate yogi pranasamghrahane kshamah//(Chapter -2, Verse 5).
Interconnection of Mind and Prana Interconnection of Mind and Prana and their controlling through Pranayama Chale vate chalam chittam nischale nischalam bhavet / Yogi
