Jalandhara Bandha – Throat lock
Jalandhara Bandha – Throat lock which prevents prana from escaping the upper body. Practice Jalandhara bandha Sit comfortably in siddhasana or padmasana). Place the palms of the hands on the knees and allow the whole body to relax. Inhale slowly and deeply through the nose and retain the breath. Lower the chin so that it touches the collarbone. At the same time, straighten the elbows and raise the shoulders. Hold the breath and the position for as long as comfortable. Then release jalandhara bandha by slowly raising the head and relaxing the shoulders. Exhale in a very slow, controlled manner. Practice five rounds, breathing normally for a few minutes between each round. Then practice five rounds with external retention (exhale and hold). Visualize the throat as a net that captures the breath as it comes up. Notice when the chin is tucked how easy it is to see your navel. Pay attention to the opening of your throat while simultaneously locking the chin. Link all the bandhas and follow the flow of breath unobstructed while maintaining the locks in the body. Notice any change in energy level or effects on your thoughts. #Yoga teacher training certification course near me Benefits Jalandhara bandha is the water pipe lock. It binds the network of subtle energy channels. Engaging Jalandhara bandha is useful for alleviating diseases of the throat. It also improves the quantum of prana in the thoracic region. By pressing the chin to the chest, prana is captured, preventing it from escaping the upper body. Many major nerve fibers pass through the neck; when jalandhara bandha is performed it exerts pressure on them and the flow of nervous impulses to the brain is restricted. These impulses collect in the cervical plexus, and when the bandha is released they flood into the brain. The force of these impulses helps to activate higher centers in the brain, those that function with creativity and intellect. #Best yoga teacher training certification courses in Bangalore
Patanjali Yoga Sutra – Kaivalya Pada: Potentiality of object
Patanjali Yoga Sutra – Kaivalya Pada: Potentiality of object 4.14. Parinamaikatvadvastutattvam| Parinama-transformation Ekatvat-due to oneness Vastu-object Tattvam-the essence The potential of the object is due to the uniqueness of transformation of the gunas. Patanjali Yoga Sutra – Kaivalya Pada #Online yoga classes India What is perception ? 4.15. Vastusamye chittabhedattayovibhaktah panthah| Vastusamye-by sameness of the object Chittabhedat-by the difference of the mind Tayoh-of these two vibhaktah –separate panthah-path of manifestation Because of the sameness of object and difference of mind their ways are different. #Online Yoga teacher training certification course near me Patanjali Yoga Sutra – Kaivalya Pada Mind & object 4.16. Na chaika chittatantram vastu tadapramanakam tada kim syat| Na-not Cha-and Eka-one Chitta-mind Tantram-dependent Vastu-object Tat-that Apramanakam-non-cognized Tada-then Kim-what Syat-would happen The object of perception is not dependent on the chitta, what would happen to the object of perception when the medium of cognition is not there?. #Online Yoga teacher training certification course near me Patanjali Yoga Sutra – Kaivalya Pada Reflection of object 4.17. Taduparagapeksitvachchittasya vastu jnatajnatam| Taduparaga-the reflection of the object in chitta Apeksitvat-because of necessity Chittasya-of the mind Vastu-object Jnata-known Ajnatam-unknown The mind needs the reflection of the objects for its cognition. Patanjali Yoga Sutra – Kaivalya Pada Purusha knows the mind 4.18. Sada jnatascittavrttayastatprabhoh purusasyaparinnamitvat| Sada-always Jnatah-are known Chittavrttayah-modifications of mind Tatprabhoh-on its master Purusasya-of the purusha Aparinamitvat-due to changelessness Purusha, the master of chitta, is chnageless, therefre, he always knows the modifications of the mind. #Online Yoga teacher training certification course near me Patanjali Yoga Sutra – Kaivalya Pada Mind is not self-illumintive 4.19. Na tatsvabhasam drsyatvat| Na-not Tat-that svabhasam –self-illumined drsyatvat-of perceptibility That chitta is not self-illumined because it is the subject of knowledge and perception. Patanjali Yoga Sutra – Kaivalya Pada Limitation of mind 4.20. Ekasamaye chobhayanavadharanam| Ekasamaye-simultaneously Cha-and Ubhaya-both Anavadharanam-non-comprehension And there cannot be the comprehension of both simultaneously. Patanjali Yoga Sutra – Kaivalya Pada Confusion of memories 4.21. Chittantaradrsye buddhibuddheratiprasangah smrtisankarascha| Chittantaradrsye-in one mind being cognized by the other Buddhibuddheh-cognition of cognitions Atiprasangah-absurd superfluity Smrti-memory Sankarah-confusion Cha-and If cognition by one mind of th eother be accepted, then there will be cognition of cognitions leading to absurdity and confusion of memory. Patanjali Yoga Sutra – Kaivalya Pada Attainment of pure consciousness or kaivalya 4.34. Purusarthasunyanam gunanam pratiprasavah kaivalyam svarupapratistha va chitisakteriti| Purusartha-purpose of the purusha Sunyanam-devoid of Gunanam-of the gunas Pratiprasavah-involution Kaivalyam-liberation Svarupa-ones own nature Pratistha-establishment Va-or Chitisakteh-purusah Iti-that’s all(denotes the end of the Patanjali Yoga Sutra) Kaivalya is the involution of the gunas because of the fulfillment of their objectives or it is the restoration of the purusha to its inherent form which is called pure consciousness. #Online Best yoga certification courses in Bangalore
Patanjali Yoga Sutra – Kaivalya Pada Dominance of action or karma
Patanjali Yoga Sutra – Kaivalya Pada Dominance of action or karma 4.7. Karmasuklakrsnam yoginastrividhamitaresam| Karma-action Asukla-not white Akrsnam-not black Yoginah-of the yogis Trividham-threefold Itaresam-of others The deed of yogis are neither white nor black, of others they are threefold. Patanjali Yoga Sutra – Kaivalya Pada Exhibition of potential desires 4.8. Tatastadvipakanugunanamevabhivyaktirvasanam| Tatah-therefrom Tadvipaka-the ripening of those Anugunanam-accordingly Eva-only Abhivyaktih-manifestation Vasanam-of potential desires Therefrom the exhibition of potential desires according to their activities, ripening only. Patanjali Yoga Sutra – Kaivalya Pada Memory & impressions 4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat| Jati-class of birth Desa-place Kala-time Vyavahitanam-separated Api-even Anantaryam-sequence Smrtisamskarayoh-of memory and impressions Ekarupatvat-because of sameness in form Because memory and impression are the same in form there is a sequence although they may be classified by class of birth, place and time. Patanjali Yoga Sutra – Kaivalya Pada Source of potential impressions 4.10. Tasamanaditvam chasiso nityatvat| Tasam-there is Anaditvam-begnninglessness Cha-and Asisah-of the will to live Nityatvat-by permanence There is no beginning to them and the desire to live is eternal. Patanjali Yoga Sutra – Kaivalya Pada Vanishing of impressions 4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah| Hetu-cause Phala-effect Asraya-support Alambanaih-object Sangrhitatvat-because of being bound together Esam-of these Abhave-on the disappearance Tadabhavah-their disappearance Since cause and effect, support and object are act together, by their disappearance that also disappears. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Past & future exist 4.12. Atitanagatam svarupo’styadhvabhedadharmanam| Atita-past Anagatam-future Svarupatah-in its essential form Asti-exists Adhvabhedat dharmanam- of inherent properties Past and future exist in their own form by difference of paths. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Reason for existence 4.13. Te vyaktasuksma gunatmanah| Te-they Vyakta-manifest Suksma-subtle Gunatmanah-of the nature of gunas Whether manifest or unmanifest they are of the nature of gunas.
Patanjali Yoga Sutra – Kaivalya Pada: Pure Mind
Patanjali Yoga Sutra – Kaivalya Pada: Pure Mind 4.4. Nirmanachittanyasmitamatrat| Nirmana-creation Chittani-minds Asmita-egoism Matrat-alone Created minds are free from egoism alone. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Pure mind controls 4.5. Pravrttibhede prayojakam chittamekamanekesam| Pravrtti-activity Bhede-in connection wit the difference Prayojakam-moving Chittam-mind Ekam-one Anekesam-of many The pure mind directs the many in related with the difference of activities. Patanjali Yoga Sutra – Kaivalya Pada Meditative mind is freee from past impressions 4.6. Tatra dhyanajamanasayam| Tatra-there, of them Dhyanajam-born of meditation Anasayam-without the store of past impressions The mind which is born out of meditation, is free of past impression or vasanas. #Online Best yoga certification courses in Bangalore
Patanjali Yoga Sutra – Kaivalya Pada: Sources of psychic powers
Patanjali Yoga Sutra – Kaivalya Pada: Sources of psychic powers Arise of psychic powers 4.1. Janmausadhimantratapahsamadhijah siddhayah| Janma-birth Ausadhi-herbs Mantra-mantra Tapah-austerity Samadhi-trance Jah-born of Siddhayah-siddhis The siddhis(psychic powers) arises of birth, herbs, mantras, tapas or austerities, or samadhi. #Online Best yoga certification courses in Bangalore Patanjali Yoga Sutra – Kaivalya Pada Inherent Transformation 4.2. Jatyantaraparinamah prakrtyapurat| Jatyantara-another birth Parinamah-transformation Prakrti-nature Apurat-by making up, overflowing By the overflow of inherent potentiality creates the transformation from one substance into other substances. Patanjali Yoga Sutra – Kaivalya Pada Instrumental cause 4.3. Nimittamaprayojakam prakrtinam varanabhedastu tatah ksetrikavat| Nimittam-instrument Aprayojakam-indirect Prakrtinam-of various natural tendencies Varana-obstacles Bhedhah-removal Tu-but Tatah-therefore Ksetrikavat-like the farmer The instrumental cause does not stir up the various natures but simply clears the obstacles in the path of transformation. #Online Best yoga certification courses in Bangalore
HATHA YOGA PRADIPIKA
HATHA YOGA PRADIPIKA The Hatha Yoga Pradipika is compiled by Yogi Swatmarama, an outstanding personality among many authorities of Hatha Yoga i.e. Goraknanath, Gheranda and Srinivasa Bhatta. Hatha Yoga is a very important science for man all the time. The beauty of the Hatha Yoga Pradipika is that it solves a very great problem of every aspirant. The term Hatha is a combination of two big mantras, i.e. Ha & tha where Ha represents mind, the mental energy. That represents prana the vitral force. So Hatha yoga means the union between the pranic and mental force. This is the awakening of higher consciousness. In another description, Ha means moon; that means sun “This is a symbolic of the twin energy forces which exists in everything. It represents the forces of mind, prana or vitality. Which constitute body and mind? The term Pradipika actually means self illuminating or that which illumines. So it is a text which illumines a multitude of physical, mental and spiritual problems for the aspirants. #Online Best yoga certification courses in Bangalore As in yoga, life and consciousness are known as Purusha and Prakriti and in Tantra they are called Shakti and Shiva, similarly in Hatha yoga they are known as Ida and Pingala. In Hatha yoga it begin by saying the one should first purify the whole body the stomach, intestines, nervous system and other systems. By discipline the body the subtle elements, the energy channels (Nadis) within the body should be purified. The behaviour of the vital life force (Prana), the entire nervous system and the various secretions in the body should be properly maintained and harmonized. In this way it will be possible to develop deep meditation. These practices will induce pratyahara and leading dharana dhyana and Samadhi. The main objective of Hatha Yoga is to create an absolute balance of the interacting activities and processes of the physical body, mind and energy. When this balance is created the impulses created give a call of awakening to the control force (Sushmana nadi) which is responsible for the evolution of human consciousness. Therefore it considers Hatha Yoga as the preliminary practice of Tantra, Raja Yoga, Kundalini Yoga and Kriya Yoga. #Online Best yoga certification courses in Bangalore Totally there are four chapters, Chapter I – Asana 67 verses Chapter II – Pranayama and Kriya 78 verses Chapter III – Mudras and Bandhas 130 verses Chapter IV – Samadhi, Nadanusandhana 114 verses Four major sources of Hatha yoga from 6th to 13th century AD. Hatha Yoga Pradipika – Svatmarama Goraksa Samitha – Gorakhnanth Gheranda Samitha – Gheranda Hatha Ratnavali – Srinivasa Bhatta OBJECTIVE Purification and harmonization of Body, Prana and Mind – leading to Raja yoga. Histroical Aspects Vedas & Upanisads – 5000 BC Bhagavad Gita – 300 BC Bhagavata – 1500 BC Patanjali Yoga Sutra – 1800 BC Buddha – 600 BC Jain – 300 BC Hatha Yoga Texts – From 1000 AD to 1600 AD #Online Best yoga certification courses in Bangalore Hatha Yoga Pradipika Four Chapters – Sadanga Yoga 1. On Asanas Yamas & Niyamas – Do’s & Dont’s Asanas – Postures 2. On Pranayamas Shatkriyas – Cleansing techniques Pranayamas – Mastery over prana 3. On Mudras Bandhas – Locks Mudras – Symbols 4. On Samadhi Samadhi – Absorb Yama & Niyama 1. Ahimsa – Non violence 2. Satya – Truthfulness 3. Asteya – Non stealing 4. Brahmacarya – Continence 5. Ksama – Forgiving 6. Dhrti – Endurance 7. Daya – Compassion 8. Arjavam – Straight forwardness 9. Mitahara – Sparing diet 10. Saucam – Cleanliness Niyamas 1. Tapas – Penance 2. Santosa – Contentment 3. Sravana – Hearing the scriptures 4. Isvara pujanam – Worship of god 5. Astikyam – Belief in god 6. Danam – Charity 7. Hrih – Modesty 8. Matih – Analysis 9. Hutam – Yajna 10. Tapah – Offering #Online Best yoga certification courses in Bangalore CHAPTER – 1 Asanas (67 Verses) Yogi Swatamaram instructs that Hatha Yoga is only for the highest stage of Yoga Astha Sidhis • Anima – The ability to become very small • Laghima – The ability to become very light or weightless • Mahima – The ability to become as large as possible • Garima – The ability to become heavy • Prapti – The ability to reach any place • Prakamya – The ability to stay under the water and to maintain the body Youthful. • Vasitva – The ability to control over all objects, Organic and inorganic • Isitva – The ability to create and destroy at will Preparations Place of Practice, the Hatha Yogi should live alone in a heritage and practice in a place where there is no hazard from rocks, fire, or water and which is in a well administered and virtuous kingdom (nation or town) where good alms can be easily attained. There are six causes of failure in Sadhna • Over eating • Exertion • Talkativeness • Adhering to rules • Company of Common people • Unsteadiness. Asana is the first part of Hatha Yoga Asana or specific body position opens the energy channels and psychic centers. The Hatha Yogis found that by developing control of the body through asana the mind is controlled. According to Hatha Ratnavali Lord Shiva taught 84 asanas, taking the examples of 84, 00,000 creations. Ghraksha Satarka says – every one of the 8, 40,000 asanas had been told by Lord Shiva. Out of them 84 postures have been selected of all the Haöha Yoga exist, Gheranda Samhita described 32 asanas and Hatha Ratnavali names the 84 asanas. Asanas presented in Hatha Yoga Pradipika. • Swasthikasana
GHERANDA SAMHITA
GHERANDA SAMHITA Gheranda Samhita is a systematically written text on yoga. It is in the form of a dialogue between Gheranda the preceptor and Chandkapali the (pupil). The yoga that has been discussed in Gheranda Samhita is called Ghathasta Yoga. “Gatha” refers to the body. Ghathasta Yoga means Yoga based approach through the body and the training of the body is the first step to the training of the mind. Obviously Ghathastha Yoga or Ghathastha Yoga deals with the Hatha Yoga practices. It describes more than 100 Yogic practices of varied nature. These practices can be classified as follows: Kriyas – 06 Dhautis – 13 Bastis – 12 Neti – 01 Lauli – 01 Kapalabhati – 03 Trataka – 01 Asanas – 32 Mudras – 25 Pratyahara – 5 Pranayama – 10 Dhyana – 3 Samadhi – 6 Total 102 In these Yogic practices there is gradual evolution of the process from Physical to Spiritual through Psychological process. Gheranda Samhita explains all the above practices in seven lessons. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – 1 On the training of the physical body The training of the body is the first step to the training of the mind. A healthy mind can exist only in a healthy body. Hence the Hatha Yoga or training of the body is the first step to the training of the mind or Raja yoga. Lesson first start with the question of Chandkapali who wishes to know the physical discipline (Yoga) leads to the knowledge of truth (Tattava Jnana). Gheranda explains there is no fetters like those of illusion (maya) no strength like that which comes from discipline (Yoga). There is no friend higher than knowledge (Jnana) and no greater enemy than egoism (Ahankara). As by learning the alphabets, through practice one can master all the sciences, so by thoroughly practicing, first the (physical) training, one requires the knowledge of the truth. By practice of yoga one can overcome maya. There are seven exercises which pertain to the training of the body. They are particularly strengthening, steadying, calming and those leading of lightness, perception and isolation. The satkarmas are the six processes which include Dhauti, Basti, Neti, Laukiki, Trataka and kapalabhati. The technique and importance of these are also given in details. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore The sapta Sadhanas are, Kriyas – For cleansing Asanas – Gives Dridhata or strength Mudras – Gives Sithirata or Steadiness Pratyahara – Gives Dhairya or calmness Pranayama – Gives lightness or Laghima Dhyana – Gives perception or pratyakshatwa Samadhi – Gives Isolation, nirtipta which is the freedom #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER -II Asanas and Postures There are 84, 00,000 asanas described by Lord Shiva, The postures are as many in the numbers of species of living creature in the universe. Among them 84 are the best and among these 32 have been found useful for mankind in this world. Sidhasana – Perfect Padmasana – Lotus Bhadrasana – Gentle Muktasana – Free Vajrasana – Adamant Swastikasana – Prosperous Simhasana – Lion Gomukhasanan – Cow – mouth Veerasana – Heroic Dhanurasana – Bow Maritasana – Crops Guptasana – Hidden Matsyasana – Fish Matsyendasana – Sage Gorakasana – Sage Paschimotanasana – Fish Utkatasana – Hazardous Sankatasana – Dangerous Mayurasana – Peacock Kukkutasana – Cock Kurmasana – Tortoise Uttanamandukasana – Frog Uttanakurmasana – Tortoise Vrikshasana – Tree Mandukasana – Frog Garndasana – Eagle Vrishasana – Bull slabhasana – Locust Makarasana – Crocodile Ustrasana – Camel Bhujangasana – Snake #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore The very first asana – namely siddhasana is described as mokkna-kavatabhedanka (which opens the doors of realization, Padmasana, Bhadrasana, Simhasana, Matsyasana, all these destroy all sorts of disease). Muktasana gives siddhis (perfection) Vajrasana gives psychic powers to the yogi. Mritasana destroy fatigue and quiten the agitations of the mind. Gorakasana gives success to the yogis; Mayurasana destroys the effect of whole some food. It produces heat in the stomach; it destroys the effect of deadly poisons. If easily cures diseases like fever etc. Makarasana increases the body heat, Bhujangasana (serpent) always increases the bodily heat, destroys all diseases and by the practice of this posture the Kundalini force is awakened. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – III Mudras There are 25 Mudras the practice of which gives senses to the yogis, they are. Mahamudra Nabho Uddiyana Jalandhara Mulabandha Maha Bandha Maha Bheda Khecari Viparita Karani Vajroli Sakticalana Tadagi Mandauki Sambhavi 20 Panca Dharma (Five Dharma) Asvini Pasini Kaki Matangini Bhujanginini These Mudras which gives happiness and emancipation. These Mudras destroys all diseases. There is nothing in the world like the Mudras for giving quick success. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER – IV Prathyahara By prathyahara all the passions like lust are destroyed. Let one bring the chitta (thinking principle) under his control by withdrawing it wherever it wanders away driven by the various objects of right, praise or censer good or bad, speech, sweet or bad, smell or taste or what ever the mind may be distracted or attracted. #50/100/200/300/500 hr Yoga teacher training certificate course Bangalore CHAPTER -V Pranayama Four things are necessary for practicing Pranayama in Good place. Suitable time Moderate food. Purification of the Nadis The purification of the Nadis is of two sorts. Samanu and Nirmanu. The Samanu is done by a mental process with Bijamantra. The Nirmanu is performed by physical cleanings. After purification of the Nadis one has to sit firmly in a posture and be in regular Pranayama. #50/100/200/300/500 hr Yoga teacher
Patanjali Yoga Sutra – Vibhuti Pada: Samyama and psychic powers
Patanjali Yoga Sutra – Vibhuti Pada: Samyama and psychic powers By samyama knowledge of past & future 3.16. Parinamatrayasamymadatitanagatajnanam| Parinama-transformation Traya-three Samymat-by samyama Atita-past Anagatah-future Jnanam-knowledge By practicing samyama on the three transformations, knowledge of past and future thing arise. By samyama knowledge of all speech 3.17. Sabdarthapratyayanamitaretaradhyasat saìkarastat pravibhagasamyamat sarvabhutarutajnanam| Sabda-word Artha-object Pratyayanam-mental content Itaretaradhyasat-because of mental superimposition Sankara-confusion Tat-that Pravibhaga-separate Samyamat-by samyama Sarvabhuta-all living beings Ruta-speech Jnanam-knowledge#Yoga course Bangalore The word, object and mental content are in a confused condition because of mutual superimposition. By practicing smyama on them separately, knowledge of the speech of all beings arises. By samyama knowledge of previous birth 3.18. Samskarasaksatkaranat purvajatijnanam| Samskara-impression Saksatkaranat-by direct impression Purva-previous Jati-birth Jnanam-knowledge By direct perception of the impressions, knowledge of previous births comes. By samyama knowledge of other’s mind 3.19. Pratyayasya parachittajnanam| Pratyayasya-of the content of the mind Para-another Chitta-mind Jnanam-knowledge By practicing samyama on the pratyayas, knowledge of others mind known. But not mental image 3.20. Na tat salambanam tasyavisayibhutatvat| Na-not Tat-that Salambanam-with support Tasya-its Avisayibhutatvat-because of not being the subject of samyama But the knowledge of other mental factors is not gained with support of the mental image because that is not the object of samyama. #Yoga course Bangalore By samyama power of invisibility 3.21. Kayarupasamyamat tatgrahyasaktistambhe chaksuhprakasasamprayoge’ntardhanam| Kaya-body Rupa-form Samyamat-by doing samyama Tat-that Grahya-receptive Sakti-power Stambhe-on suspension ChakSuh-the eye Prakasa-light Samprayoga-absence of contact Antardhanam-being invisible By applying samyama on the form of the body and suspended receptivity of the form, there being no contact between the eye and the light, the yogi can become invisible. By samyama power of disappearance 3.22. Etena sabdadyantardhanamuktam| Etena-by this Sabdadi-sound and others Antardhanam-disaapearance Uktam-said By what has been said the vanish of sound and other tanmatras can be understood. #Yoga course Bangalore By samyama knowledge of time of death 3.23.Sopakramamnirupakramam cha karma tatsamyamadaparantajnanamapyaristebhyo va| Sopakramam-the karma which activity Nirupakramam-the karma that is dormant Cha-and Karma-action Tat-that Samyamad-by performing samyama Aparanta-death Jnanam-knowledge Aristebhyah-by omens Va-or Karma is of two types, active and dormant. By applying samyama on them knowledge of death is gained, also by omens. By samyama power of friendliness 3.24. Maitryadisu balani| Maitri-frienliness Adisu-etc Balani-powers By applying samyama on friendliness, etc. there come those particular powers friendliness. By samyama attainment of strength 3.25. Balesu hastibaladini| Balesu-by samyama on the powers Hasti-elephant Bala-stength Adini-etc By applying samyama on the stenght of an elephant, etc. the corresponding strength is gained. By samyama gain hidden knowledge 3.26. Pravrttyalokanyasat suksmavyavahitaviprakrstarsva jnanam| Pravrtti-super physical faculty Aloka-like Nyasat-by projecting Suksma-fine Vyavahita-hidden Viprakrsta-distant Jnanam-knowledge The knowledge of subtle, obscure or distant objects is profited by dilating the light of the superphysical faculty. By samyama knowledge of the solar system 3.27. Bhuvanajnanam suryasamyamat| Bhuvana-solar system Jnanam-knowledge Surye-on the sun Samyamat-by performinf samyama Knowledge of the solar system is gained by applying samyama on the sun. By samyama knowledge of the stars 3.28. Candre taravyuhajnanam| Candre-moon Tara-stars Vyuha-arrangements Jnanam-knowledge By applying samyama on the moon, knowledge about the position of the stars is benefited. #Yoga course Bangalore By samyama knowledge of star movements 3.29. Dhruve tadgatijnanam| Dhruve-by performing samyama on the pole star Tat-that Gati-movement Jnanam-knowledge By applying samyama on the pole star, knowledge of the movement of the stars can be acquired. #Yoga course Bangalore By samyama knowledge of the body 3.30. Nabhichakre kayavyuhajnanam| Nabhi-navel Chakre-centre Kaya-body Vyuha-arrangement Jnanam-knowledge By applying samyama on the navel centre, knowledge of the arrangements in the body is obtained. By samyama mastery over hunger & thirst 3.31. Kanthakupe ksutpipasa nivrttih| Kanthakupe-by performing samyama on the throat Ksut-hunger Pipasa-thirst Nivrttih-retirement By applying samyama on the throat pit, hunger and thirst would not happen. 3.32. Kurmanadyam sthairyam| Kurmanadyam-by performing samyama on the kurma nadi Sthairyam-staediness Stableness is gained by applying samyama on the kurma nadi. #Yoga course Bangalore By samyama gain spiritual vision 3.33. Murdhajyotisi siddhadarsanam| Murdha-crown of the head Jyotisi-on the light Siddha-adept Darsanam-spiritual vision By applying smayama on the light of the crown of the head at sahasrara cakra, a spiritual vision of the masters of yoga is obtained. By samyama acquire intuitive knowledge 3.34. Pratibhadva sarvam| Pratibhat-from pratibha Va-or Sarvam-everything Or everything by virtue os pratibha or intuition. By samyama gain awareness of consciouness 3.35. Hradaye chittasamvit| Hradaye-by performing smayama on the heart Chittasamvit-awareness of the consciousness By applying samyama on the heart, awareness of consciouness dawns. #Yoga course Bangalore By samyama knowledge of universal consciousness 3.36. Sattva purusayoratyantasanké rnayoh pratyayaviseso bhogah pararthatvat svarthasamyamat purusa jnanam| Sattva-chitta Purusayoh-of the purusha Atyanta-extremely Asankirnayoh-distinct Pratyaya-awareness Avisesah-not distinct Bhogah-experience Pararthatvat-from objective consciousness Sva-ones own Artha-subjective awareness Samyamat-by samyama Purusajnanam-knowledge of purusha Chitta and purusha are extremly different. On account of non-difference of the awareness of both there is objective or subjective experience. By applying samyama on subjective awareness apart from objectives awareness, the knowledge of purusha is acquired. By samyama gain power of intuitive perception 3.37. Tatah pratibhasravanavedanadarsasvadavartta jayante, Tatah-therefrom Pratibha-the faculty of superior consciousness Sravana-the faculty of hearing Vedana-touch consciousness Darsa-visulization Asvada-faculty of taste Vartta-the olfactory faculty Jayante-are produced By applying samyama gain power of intuitive perception, therefrom are produced transcendental audition, sensation, perception, taste and olfactory knowledge. #Yoga course Bangalore
Patanjali Yoga Sutra – Vibhuti Pada – Psychic powers are obstacles in path of Yoga
Patanjali Yoga Sutra – Vibhuti Pada – Psychic powers are obstacles in path of Yoga 3.38. Te samadhvupasarga vyutthane siddhayah| Te-they Samadhau-in samadhi Upasarga-obstacles Vyuttane-in the state of the consciousness of the world Siddhayah-psychics powers These psychic powers or siddhis are hindrances in path of samadhi, but in the state of consciousness of the world they are psychic powers. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of entering another’s body 3.39. Bandhakaranasaithilyat pracarasamvedanachcha chittasya parasarirapravesah| Bandha-bondage Karana-cause Saithilyat-by loosening Prachara-passage Samvedanat-by knowledge Cha-and Chittasya-of the subtle body Para-of others Sarira-body Avesah-entry By releasing of the cause of bondage and by knowledge of the passage, the subtle body enters another person’s body. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of levitation 3.40. Udanajayajjalapankakantakadisvasanga utkrantischa| Udana-one of the five pranas Jayat-by mastery Jala-water Panka-mud Kantakadisu-with thorns etc. Asanga-no contact Utkrantih-levitation Cha-and By samyama on udana upa prana there is non-contact with water, mud, thorns etc. and the body gets levitated. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain Aura 3.41. Samanajayajjvalanam| Samana-the samana vayu Jayat-by mastery Jvalanam-blaze By applying samyama on the samana vayu, the body blazes. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain power of divine hearing 3.42. Srotrakasayoh sambandhasaàyamaddivyam srotram| Srotra-ear Akasayoh-space Sambandha-relation Samyamat-by samyama Divyam-divine Srotram-organ of hearing By applying samyama on the relation of the ear and space, gained divine hearing. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain faculty of moving through space 3.43. Kayakasayoh sambandhasamyamallaghutulasamapatteschakasagamanam| Kaya-body Akasayoh-of space Sambandha-relation Samyamat-by samyama Laghu-light Tula-cotton, wool Samapatteh-by fusion of mind Cha-and Akasa-space Gamanam-going through By applying samyama on the relation of body and space and by joining the mind wit the lightness of cotton, there is going through space. #200 hour Yoga teacher training certificate course in Bangalore Gain universal state of mind 3.44. Bahirakalpita vrttirmahavideha tatah prakasavaranaksayah| Bahih-external Akalpita-unimaginable Vrttih-state of mind Mahavideha-existence wihout body Tatah-therefrom Prakasa-light Avarana-covering Ksayah-distraction In the state of, existence without body, the vrittis are inconceivable and outside the scope of the body, whereby the covering of light is destroyed. #200 hour Yoga teacher training certificate course in Bangalore By samyama mastery over twenty five tattvas or bhutas 3.45.Sthulasvarupasuksmanvayarthavattvasamyamadbhutajayah| Sthula-gross Svarupa-real form Suksma-subtle Anvaya-interpenetrating Arthavattva-serving the purpose Samyamad-by samyama Bhutajayah-mastery over elements By performing samayama on the gross, basic, subtle and interpenetrating states and the purpose of the bhutas, mastery over them is gained. #200 hour Yoga teacher training certificate course in Bangalore By samyama attainment of eight psychic powers(asta siddhis) 3.46.Tato’nimadipradurbhavah kayasampattaddharmanabhighatascha| Tatah-therefrom Animadi-anima etc. Pradurbhavah-appearance Kayasampat-bodily well Tat-that Dharma-function Anabhighatah-non-obstructions Cha-and From that the appearance of anima, perfection of the body and non-obstruction from the functions of the body gained. #200 hour Yoga teacher training certificate course in Bangalore Perfection of the physical body 3.47. Rupalavanyabalavajrasamhananatvani kayasampat| Rupa-form, beauty Lavanya-grace Bala-stength Vajrasamhananatvani- hardness Kaya-physical Sampat-wealth The perfection of the physical body includes beauty, grace, energy, and hardness. #200 hour Yoga teacher training certificate course in Bangalore By samyama mastery of sense organs 3.48. Grahanasvarupasmitanvayasamyamadindriyajayah| Grahana-power of cognition Svarupa-real nature Asmita-egoism Anvayarthavatva samyamat-by samyama Indriyajayah-mastery over the sense organs Mastery over the sense organs is obtained by applying samyama on the power of cognition, real nature, egoism, all-pervasiveness and purposefulness. #200 hour Yoga teacher training certificate course in Bangalore Mastery over prakriti 3.49. Tato manojavitvam vikaranabhavah pradhanajayascha| Tatah-therefrom Manojavitvam-speed of mind Vikaranabhavah-freedom from sense organs Pradhanajayah-conquest of prakriti Cha-and Therefrom follows speed like that of mind, independent from any medium of instrumentality and mastery of the limitations of prakriti. #200 hour Yoga teacher training certificate course in Bangalore By samyama power of omnipotence & omniscience 3.50. Sattvapurushanyatakhyatimatrasya sarvabhavadhisthatrtvam sarvajnatrtvam cha| Sattva-chitta Purusha-self Anyata-difference Khyati-awareness Matrasya-only Sarva-all Bhava-states of existence Adhisthatrtvam-supermacy Sarvajnatrtvam-omniscience Cha-and Just by knowledge of the awareness of the difference between chitta and purusha follows supermacy over all states and forms of existence and omniscience. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain detachment and knowledge 3.51. Tadvairagyadapi dosabijaksaye kaivalyam| Tat-that Vairagyat-by vairagya Api-even Dosa-defect Bija-seed Ksaye-due to destruction Kaivalyam-isolation By detachment, even regarding the powers, the seed of defect is eliminated and kaivalya is reached. #200 hour Yoga teacher training certificate course in Bangalore Causes of downfall in spiritual path 3.52. Sthanyupanimantrane sangasmayakaranam punanistaprasangat| Sthani-gods Upanimantrane-on being respectfully Sanga-attachment Smaya-pride Akaranam-by not Punah-once again Anista-undesirable Prasangat-by revival On being invited by the gods there should be no attachment and pride, because of the possibility of revival of the undesirable. #200 hour Yoga teacher training certificate course in Bangalore By samyama gain awareness of ultimate reality 3.53. Ksana tatkramayo samyamdvivekajam jnanam| Ksana-moment Tatkramayoh-its order of succession Samyamat-by samyama Vivekjam-born of realization Jnanam-knowledge By applying samyama on moment and its order of succession is born the knowledge of realization of the ultimate reality. By samyama knowledge of distinctions 3.54. Jatialaksana desairanyatanavachchhedat tulyayostatah pratipattih| Jati-birth Laksana-charaterictic Desayoh-by place Anyata-difference Anavachchhedat-on account of no definiton Tulyayoh-of the two similar objects Tatah-therefrom Pratipattih-knowledge By samyama transcendental knowledge 3.55. Tarakam sarvavisayam sarvatha visayamakramam cheti vivekajam jnanam| Tarakam-transcendental Sarvavisayam-all subjects sarvatha visayam-object of every place akramam-beyond the order of successon cha-and iti-that is all vivekajam jnanam- knowledge born of viveka Transcendental knowledge includes the knowledge of all objects beyond all orders of succession and is born of discrimination. Attainment of kaivalya 3.56. Sattvapurusayoh suddhisamye kaivalyamiti| Sattva-chitta Purusayoh-of the purusha Suddhi-purification Samye-on becoming equal Kaivalyam-isolation Iti-end Kaivalya is attained by equalizing and cleansing the illumination of purusha and chitta.
Patanjali Yoga Sutra-Vibhuti Pada – What is Concentration?
Patanjali Yoga Sutra – Vibhuti Pada – What is Concentration? 3.1 Desabandhaschittasya dharana | #Yoga teacher training certificate course fees in Bangalore Desa-place Bandha-binding Chittasya-of the mind Dharana-concentration Cocentration is bringing the mind to one place with effort. #Yoga teacher training certificate course fees in Bangalore Patanjali Yoga Sutra – Vibhuti Pada What is Meditation? 3.2. Tatra pratyayaikatanata dhyanam| Tatra-there(in the desha) Pratyaya-basis or content of consciousness Ekatanata-continuity Dhyanam-meditation Uninterrupted stream of the content of consciouness is Meditation. #Yoga teacher training certificate course fees in Bangalore Patanjali Yoga Sutra – Vibhuti Pada What is Samadhi or superconsciousness? 3.3.Tadevarthamatranirbhasaà svarupasunyamiva samadhih| Tadeva-the same Artha-the object of dhayana Matra-only Nirbhasam-appearing Svarüpa-one own form Sunyam-empty Iva-as if Samadhih-trance Samadhi is called, when there is only the object appearing without the consciousness of ones own self.