Skip to main content

Karuna Yoga Vidya Peetham Bangalore

karuna yoga vidya peetham logo

Patanjali Yoga Sutra – Kaivalya Pada Dominance of action or karma

4.7. Karmasuklakrsnam yoginastrividhamitaresam|

  • Karma-action
  • Asukla-not white
  • Akrsnam-not black
  • Yoginah-of the yogis
  • Trividham-threefold
  • Itaresam-of others

The deed of yogis are neither white nor black, of others they are threefold.

Patanjali Yoga Sutra – Kaivalya Pada

Exhibition of potential desires

4.8. Tatastadvipakanugunanamevabhivyaktirvasanam|

  • Tatah-therefrom
  • Tadvipaka-the ripening of those
  • Anugunanam-accordingly
  • Eva-only
  • Abhivyaktih-manifestation
  • Vasanam-of potential desires

Therefrom the exhibition of potential desires according to their activities, ripening only.

Patanjali Yoga Sutra – Kaivalya Pada

Memory & impressions

4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat|

  • Jati-class of birth
  • Desa-place
  • Kala-time
  • Vyavahitanam-separated
  • Api-even
  • Anantaryam-sequence
  • Smrtisamskarayoh-of memory and impressions
  • Ekarupatvat-because of sameness in form

Because memory and impression are the same in form there is a sequence although they may be classified by class of birth, place and time.

Patanjali Yoga Sutra – Kaivalya Pada

Source of potential impressions

4.10. Tasamanaditvam chasiso nityatvat|

  • Tasam-there is
  • Anaditvam-begnninglessness
  • Cha-and
  • Asisah-of the will to live
  • Nityatvat-by permanence

There is no beginning to them and the desire to live is eternal.

Patanjali Yoga Sutra – Kaivalya Pada

Vanishing of impressions

4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah|

  • Hetu-cause
  • Phala-effect
  • Asraya-support
  • Alambanaih-object
  • Sangrhitatvat-because of being bound together
  • Esam-of these
  • Abhave-on the disappearance
  • Tadabhavah-their disappearance

Since cause and effect, support and object are act together, by their disappearance that also disappears.

#Online  Best yoga certification courses in Bangalore

Patanjali Yoga Sutra – Kaivalya Pada

Past & future exist

4.12. Atitanagatam svarupo’styadhvabhedadharmanam|

  • Atita-past
  • Anagatam-future
  • Svarupatah-in its essential form
  • Asti-exists
  • Adhvabhedat dharmanam- of inherent properties

Past and future exist in their own form by difference of paths.

#Online  Best yoga certification courses in Bangalore

Patanjali Yoga Sutra – Kaivalya Pada

Reason for existence

4.13. Te vyaktasuksma gunatmanah|

  • Te-they
  • Vyakta-manifest
  • Suksma-subtle
  • Gunatmanah-of the nature of gunas

Whether manifest or unmanifest they are of the nature of gunas.

Leave a Reply

Your email address will not be published. Required fields are marked *

[gravityform id="2" title=false]
Call Back Form