Patanjali Yoga Sutra – Kaivalya Pada Dominance of action or karma
4.7. Karmasuklakrsnam yoginastrividhamitaresam|
- Karma-action
- Asukla-not white
- Akrsnam-not black
- Yoginah-of the yogis
- Trividham-threefold
- Itaresam-of others
The deed of yogis are neither white nor black, of others they are threefold.
Patanjali Yoga Sutra – Kaivalya Pada
Exhibition of potential desires
4.8. Tatastadvipakanugunanamevabhivyaktirvasanam|
- Tatah-therefrom
- Tadvipaka-the ripening of those
- Anugunanam-accordingly
- Eva-only
- Abhivyaktih-manifestation
- Vasanam-of potential desires
Therefrom the exhibition of potential desires according to their activities, ripening only.
Patanjali Yoga Sutra – Kaivalya Pada
Memory & impressions
4.9. Jatidesakalavyavahitanamapyantaryam smrtisamskarayorekarupatvat|
- Jati-class of birth
- Desa-place
- Kala-time
- Vyavahitanam-separated
- Api-even
- Anantaryam-sequence
- Smrtisamskarayoh-of memory and impressions
- Ekarupatvat-because of sameness in form
Because memory and impression are the same in form there is a sequence although they may be classified by class of birth, place and time.
Patanjali Yoga Sutra – Kaivalya Pada
Source of potential impressions
4.10. Tasamanaditvam chasiso nityatvat|
- Tasam-there is
- Anaditvam-begnninglessness
- Cha-and
- Asisah-of the will to live
- Nityatvat-by permanence
There is no beginning to them and the desire to live is eternal.
Patanjali Yoga Sutra – Kaivalya Pada
Vanishing of impressions
4.11. Hetuphalasrayalambanaih sangrahitatvadesamabhave tadabhavah|
- Hetu-cause
- Phala-effect
- Asraya-support
- Alambanaih-object
- Sangrhitatvat-because of being bound together
- Esam-of these
- Abhave-on the disappearance
- Tadabhavah-their disappearance
Since cause and effect, support and object are act together, by their disappearance that also disappears.
#Online Best yoga certification courses in Bangalore
Patanjali Yoga Sutra – Kaivalya Pada
Past & future exist
4.12. Atitanagatam svarupo’styadhvabhedadharmanam|
- Atita-past
- Anagatam-future
- Svarupatah-in its essential form
- Asti-exists
- Adhvabhedat dharmanam- of inherent properties
Past and future exist in their own form by difference of paths.
#Online Best yoga certification courses in Bangalore
Patanjali Yoga Sutra – Kaivalya Pada
Reason for existence
4.13. Te vyaktasuksma gunatmanah|
- Te-they
- Vyakta-manifest
- Suksma-subtle
- Gunatmanah-of the nature of gunas
Whether manifest or unmanifest they are of the nature of gunas.
